KEGG   Homo sapiens (human): 7109
Entry
7109              CDS       T01001                                 

Gene name
TRAPPC10, EHOC-1, EHOC1, GT334, TMEM1, TRS130, TRS30
Definition
(RefSeq) trafficking protein particle complex 10
  KO
K20307  trafficking protein particle complex subunit 10
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    7109 (TRAPPC10)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Tethering complex
   TRAPP complex II
    7109 (TRAPPC10)
SSDB
Motif
Pfam: TRAPPC10 Foie-gras_1 SNAP
Other DBs
NCBI-GeneID: 7109
NCBI-ProteinID: NP_003265
OMIM: 602103
HGNC: 11868
Ensembl: ENSG00000160218
Vega: OTTHUMG00000086894
Pharos: P48553(Tbio)
UniProt: P48553
Position
21q22.3
AA seq 1259 aa
MDASEEPLPPVIYTMENKPIVTCAGDQNLFTSVYPTLSQQLPREPMEWRRSYGRAPKMIH
LESNFVQFKEELLPKEGNKALLTFPFLHIYWTECCDTEVYKATVKDDLTKWQNVLKAHSS
VDWLIVIVENDAKKKNKTNILPRTSIVDKIRNDFCNKQSDRCVVLSDPLKDSSRTQESWN
AFLTKLRTLLLMSFTKNLGKFEDDMRTLREKRTEPGWSFCEYFMVQEELAFVFEMLQQFE
DALVQYDELDALFSQYVVNFGAGDGANWLTFFCQPVKSWNGLILRKPIDMEKRESIQRRE
ATLLDLRSYLFSRQCTLLLFLQRPWEVAQRALELLHNCVQELKLLEVSVPPGALDCWVFL
SCLEVLQRIEGCCDRAQIDSNIAHTVGLWSYATEKLKSLGYLCGLVSEKGPNSEDLNRTV
DLLAGLGAERPETANTAQSPYKKLKEALSSVEAFEKHYLDLSHATIEMYTSIGRIRSAKF
VGKDLAEFYMRKKAPQKAEIYLQGALKNYLAEGWALPITHTRKQLAECQKHLGQIENYLQ
TSSLLASDHHLTEEERKHFCQEILDFASQPSDSPGHKIVLPMHSFAQLRDLHFDPSNAVV
HVGGVLCVEITMYSQMPVPVHVEQIVVNVHFSIEKNSYRKTAEWLTKHKTSNGIINFPPE
TAPFPVSQNSLPALELYEMFERSPSDNSLNTTGIICRNVHMLLRRQESSSSLEMPSGVAL
EEGAHVLRCSHVTLEPGANQITFRTQAKEPGTYTLRQLCASVGSVWFVLPHIYPIVQYDV
YSQEPQLHVEPLADSLLAGIPQRVKFTVTTGHYTIKNGDSLQLSNAEAMLILCQAESRAV
VYSNTREQSSEAALRIQSSDKVTSISLPVAPAYHVIEFELEVLSLPSAPALGGESDMLGM
AEPHRKHKDKQRTGRCMVTTDHKVSIDCPWSIYSTVIALTFSVPFRTTHSLLSSGTRKYV
QVCVQNLSELDFQLSDSYLVDTGDSTDLQLVPLNTQSQQPIYSKQSVFFVWELKWTEEPP
PSLHCRFSVGFSPASEEQLSISLKPYTYEFKVENFFTLYNVKAEIFPPSGMEYCRTGSLC
SLEVLITRLSDLLEVDKDEALTESDEHFSTKLMYEVVDNSSNWAVCGKSCGVISMPVAAR
ATHRVHMEVMPLFAGYLPLPDVRLFKYLPHHSAHSSQLDADSWIENDSLSVDKHGDDQPD
SSSLKSRGSVHSACSSEHKGLPMPRLQALPAGQVFNSSSGTQVLVIPSQDDHVLEVSVT
NT seq 3780 nt   +upstreamnt  +downstreamnt
atggacgcctctgaggagccgctgccgccggtgatctacaccatggagaacaagcccatc
gtcacctgtgctggagatcagaatttatttacctctgtttatccaacgctctctcagcag
cttccaagagaaccaatggaatggagaaggtcctatggccgggctccgaagatgattcac
ctagagtctaactttgttcaattcaaagaggagctgctgcccaaagaaggaaacaaagct
ctgctcacgtttcccttcctccatatttactggacagagtgctgtgataccgaagtgtat
aaagctacagtaaaagatgacctcaccaagtggcagaatgttctgaaggctcatagctct
gtggactggttaatagtgatagttgaaaatgatgccaagaaaaaaaacaaaaccaacatc
cttccccgaacctctattgtggacaaaataagaaatgatttttgtaataaacagagtgac
aggtgtgttgtgctctccgaccccttgaaggactcttctcgaactcaggaatcctggaat
gccttcctgaccaaactcaggacattgcttcttatgtcttttaccaaaaacctaggcaag
tttgaggatgacatgagaaccttgagggagaagaggactgagccaggctggagcttttgt
gaatatttcatggttcaggaggagcttgcctttgttttcgagatgctgcagcagttcgag
gacgccctggtgcagtacgacgaactggacgccctcttctctcagtatgtggtcaacttc
ggggccggggatggtgccaactggctgacttttttctgccagccagtgaagagctggaac
ggattgatcctccgaaaacccatagatatggagaagcgggaatcgatccagaggcgagaa
gccaccctgttagatctgcgcagttacctgttctctcgccagtgcaccttgctgctcttc
ctgcagaggccgtgggaggtggcccagcgcgccctagagctgctgcacaactgcgtgcag
gaactgaagctcttagaagtctctgtcccacctggtgctctggactgctgggtgtttctg
agctgtctggaggtgttgcagaggatagaaggctgctgtgaccgggcacagatcgactca
aacattgcccacactgtggggctatggagctatgccacagaaaagttaaagtccttgggc
tatctatgtggacttgtgtcagagaaaggacctaactcagaagatctcaacaggacagtt
gaccttttggcaggtttgggagctgagcgaccagaaacagccaacacagctcagagtcct
tataagaaactgaaagaagcattatcgtcagtggaagcttttgaaaaacactacttagat
ttgtcccatgccaccattgaaatgtatacaagcattgggaggattcgatctgctaagttt
gttggaaaagatctggcagagttttacatgaggaaaaaggctccacaaaaggcagaaatc
tatcttcaaggagcactgaaaaactacctggctgagggctgggcactccccatcacacac
acaaggaagcagctggccgaatgtcaaaagcaccttggacaaattgaaaactacctgcag
accagcagcctcttagccagtgaccaccacctcactgaagaggagcgcaagcacttctgc
caggagatacttgactttgccagccagccgtcagacagcccaggtcataagatagtgcta
cccatgcattcctttgcacaactgcgagatctccattttgatccctccaatgccgtggtc
cacgtgggcggcgttttgtgcgttgagataaccatgtacagccagatgcctgtgcctgtt
cacgtggagcagattgtggtcaatgtccacttcagcattgagaaaaacagctaccggaag
actgcggagtggcttaccaagcacaagacgtccaatgggatcattaactttccacccgag
accgcacctttccctgtatcccaaaacagtttgcccgcgctggagttgtatgaaatgttt
gagagaagcccatctgataactccttgaacacgactgggattatctgcagaaacgtccac
atgctcctgagaaggcaggagagcagctcctctctagagatgccctcaggggtggctctg
gaggagggtgcccacgtgctgaggtgcagccacgtgaccctggaaccaggggccaaccag
ataacattcaggactcaggccaaggaacctggaacgtatacactcaggcagctgtgcgcc
tcggtgggctccgtgtggttcgtcctccctcacatctaccccattgtgcagtacgacgtg
tactcacaggagccccagctgcacgtggagccgctggctgatagccttctggcaggcatt
cctcagagagtcaagttcactgtcactaccggccattatacgataaagaatggagacagc
ctgcagcttagcaatgccgaagccatgctcatcctgtgccaggcggagagcagggctgtg
gtctactccaacacgagagaacagtcttctgaggccgcgctccggattcagtcctccgac
aaggtcacgagcatcagtctgcctgttgcgcctgcgtaccacgtgatcgaatttgaactg
gaagttctctctttaccttcagccccagcactcggaggggagagtgacatgctggggatg
gcagagccccacaggaagcataaggacaaacagagaactggccgctgcatggttaccaca
gaccacaaagtgtcgattgactgcccgtggtccatctactccacagtcatcgcactgacc
ttcagcgtacccttcaggaccacacacagcctcctgtcctcaggaacacggaaatatgtt
caagtttgtgtccagaatttgtcagaacttgactttcagctgtcagatagttatcttgta
gataccggtgatagtaccgacctgcaactagtaccactgaacacgcagtcccagcagccc
atctacagcaagcagtcggtgttcttcgtctgggaactcaagtggacagaagagcctccc
ccttctctgcattgccggttctctgttggattttccccagcttctgaggaacagctgtct
atctccttaaagccgtatacttatgaatttaaagtggaaaatttttttacattatacaac
gtgaaggctgagatctttcccccttcgggaatggagtattgcagaacaggctccctctgc
tccctggaggttttgatcacgaggctctcagacctcttggaggtggataaagatgaagca
ctgactgaatctgatgagcatttttcgacaaagcttatgtatgaagttgtcgacaacagt
agcaactgggcagtgtgtgggaaaagctgcggtgtcatctccatgccagtggctgctcgg
gccactcacagggtccacatggaagtgatgccgctcttcgccgggtatctccccctgccc
gacgtcaggctgttcaagtacctcccccatcattctgcacactcctcccaactggacgct
gacagctggatagaaaacgacagcctgtcagtagacaagcacggggacgaccagccggac
agcagcagcctcaagagcaggggcagcgtgcattcggcctgcagcagcgagcacaaaggc
ctacccatgccccggctgcaggcactgccggccggccaggtcttcaactccagctcgggc
acacaagtcctggtcatccccagccaagatgaccacgtcctggaagtcagtgtaacatga

DBGET integrated database retrieval system