KEGG   Homo sapiens (human): 7143Help
Entry
7143              CDS       T01001                                 

Gene name
TNR, TN-R
Definition
(RefSeq) tenascin R
  KO
K06252  tenascin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04512  ECM-receptor interaction
hsa05165  Human papillomavirus infection
hsa05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    7143 (TNR)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    7143 (TNR)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    7143 (TNR)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    7143 (TNR)
  Infectious diseases
   05165 Human papillomavirus infection
    7143 (TNR)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
   7143 (TNR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: fn3 Fibrinogen_C EGF_2 Pur_ac_phosph_N Uroplakin_II EGF
Motif
Other DBs
NCBI-GeneID: 7143
NCBI-ProteinID: NP_003276
OMIM: 601995
HGNC: 11953
Ensembl: ENSG00000116147
Vega: OTTHUMG00000034876
Pharos: Q92752(Tbio)
UniProt: Q92752 A1L306
Position
1q25.1
AA seq 1358 aa AA seqDB search
MGADGETVVLKNMLIGINLILLGSMIKPSECQLEVTTERVQRQSVEEEGGIANYNTSSKE
QPVVFNHVYNINVPLDNLCSSGLEASAEQEVSAEDETLAEYMGQTSDHESQVTFTHRINF
PKKACPCASSAQVLQELLSRIEMLEREVSVLRDQCNANCCQESAATGQLDYIPHCSGHGN
FSFESCGCICNEGWFGKNCSEPYCPLGCSSRGVCVDGQCICDSEYSGDDCSELRCPTDCS
SRGLCVDGECVCEEPYTGEDCRELRCPGDCSGKGRCANGTCLCEEGYVGEDCGQRQCLNA
CSGRGQCEEGLCVCEEGYQGPDCSAVAPPEDLRVAGISDRSIELEWDGPMAVTEYVISYQ
PTALGGLQLQQRVPGDWSGVTITELEPGLTYNISVYAVISNILSLPITAKVATHLSTPQG
LQFKTITETTVEVQWEPFSFSFDGWEISFIPKNNEGGVIAQVPSDVTSFNQTGLKPGEEY
IVNVVALKEQARSPPTSASVSTVIDGPTQILVRDVSDTVAFVEWIPPRAKVDFILLKYGL
VGGEGGRTTFRLQPPLSQYSVQALRPGSRYEVSVSAVRGTNESDSATTQFTTEIDAPKNL
RVGSRTATSLDLEWDNSEAEVQEYKVVYSTLAGEQYHEVLVPRGIGPTTRATLTDLVPGT
EYGVGISAVMNSQQSVPATMNARTELDSPRDLMVTASSETSISLIWTKASGPIDHYRITF
TPSSGIASEVTVPKDRTSYTLTDLEPGAEYIISVTAERGRQQSLESTVDAFTGFRPISHL
HFSHVTSSSVNITWSDPSPPADRLILNYSPRDEEEEMMEVSLDATKRHAVLMGLQPATEY
IVNLVAVHGTVTSEPIVGSITTGIDPPKDITISNVTKDSVMVSWSPPVASFDYYRVSYRP
TQVGRLDSSVVPNTVTEFTITRLNPATEYEISLNSVRGREESERICTLVHTAMDNPVDLI
ATNITPTEALLQWKAPVGEVENYVIVLTHFAVAGETILVDGVSEEFRLVDLLPSTHYTAT
MYATNGPLTSGTISTNFSTLLDPPANLTASEVTRQSALISWQPPRAEIENYVLTYKSTDG
SRKELIVDAEDTWIRLEGLLENTDYTVLLQAAQDTTWSSITSTAFTTGGRVFPHPQDCAQ
HLMNGDTLSGVYPIFLNGELSQKLQVYCDMTTDGGGWIVFQRRQNGQTDFFRKWADYRVG
FGNVEDEFWLGLDNIHRITSQGRYELRVDMRDGQEAAFASYDRFSVEDSRNLYKLRIGSY
NGTAGDSLSYHQGRPFSTEDRDNDVAVTNCAMSYKGAWWYKNCHRTNLNGKYGESRHSQG
INWYHWKGHEFSIPFVEMKMRPYNHRLMAGRKRQSLQF
NT seq 4077 nt NT seq  +upstreamnt  +downstreamnt
atgggggcagatggggaaacagtggttctgaagaacatgctcattggcatcaacctgatc
cttctgggctccatgatcaagccttcagagtgtcagctggaggtcaccacagaaagggtc
cagagacagtcagtggaggaggagggaggcattgccaactacaacacatccagcaaagag
cagcctgtggtcttcaaccacgtgtacaacattaacgtgcccttggacaacctctgctcc
tcagggctagaggcctctgctgagcaggaggtgagtgcagaagacgagactctggcagag
tacatgggccagacctcagaccacgagagccaggtcacctttacacacaggatcaacttc
cccaaaaaggcctgtccatgtgccagttcagcccaggtgctgcaggagctgctgagccgg
atcgagatgctggagagggaggtgtcggtgctgcgagaccagtgcaacgccaactgctgc
caagaaagtgctgccacaggacaactggactatatccctcactgcagtggccacggcaac
tttagctttgagtcctgtggctgcatctgcaacgaaggctggtttggcaagaattgctcg
gagccctactgcccgctgggttgctccagccggggggtgtgtgtggatggccagtgcatc
tgtgacagcgagtacagcggggatgactgttccgaactccggtgcccaacagactgcagc
tcccgggggctctgcgtggacggggagtgtgtctgtgaagagccctacactggcgaggac
tgcagggaactgaggtgccctggggactgttcggggaaggggagatgtgccaacggtacc
tgtttatgcgaggagggctacgttggtgaggactgcggccagcggcagtgtctgaatgcc
tgcagtgggcgaggacaatgtgaggaggggctctgcgtctgtgaagagggctaccagggc
cctgactgctcagcagttgcccctccagaggacttgcgagtggctggtatcagcgacagg
tccattgagctggaatgggacgggccgatggcagtgacggaatatgtgatctcttaccag
ccgacggccctggggggcctccagctccagcagcgggtgcctggagattggagtggtgtc
accatcacggagctggagccaggtctcacctacaacatcagcgtctacgctgtcattagc
aacatcctcagccttcccatcactgccaaggtggccacccatctctccactcctcaaggg
ctacaatttaagacgatcacagagaccaccgtggaggtgcagtgggagcccttctcattt
tccttcgatgggtgggaaatcagcttcattccaaagaacaatgaagggggagtgattgct
caggtccccagcgatgttacgtcctttaaccagacaggactaaagcctggggaggaatac
attgtcaatgtggtggctctgaaagaacaggcccgcagcccccctacctcggccagcgtc
tccacagtcattgacggccccacgcagatcctggttcgcgatgtctcggacactgtggct
tttgtggagtggattccccctcgagccaaagtcgatttcattcttttgaaatatggcctg
gtgggcggggaaggtgggaggaccaccttccggctgcagcctcccctgagccaatactca
gtgcaggccctgcggcctggctcccgatacgaggtgtcagtcagtgccgtccgagggacc
aacgagagcgattctgccaccactcagttcacaacagagatcgatgcccccaagaacttg
cgagttggttctcgcacagcaaccagccttgacctcgagtgggataacagtgaagccgaa
gttcaggagtacaaggttgtgtacagcaccctggcgggtgagcaatatcatgaggtactg
gtccccaggggcattggtccaaccaccagggccaccctgacagatctggtacctggcact
gagtatggagttggaatatctgccgtcatgaactcacagcaaagcgtgccagccaccatg
aatgccaggactgaacttgacagtccccgagacctcatggtgacagcctcctcggagacc
tccatctccctcatctggaccaaggccagtggccccattgaccactaccgaattaccttt
accccatcctctgggattgcctcagaagtcaccgtacccaaggacaggacctcatacaca
ctaacagatctagagcctggggcagagtacatcatttccgtcactgctgagaggggtcgg
cagcagagcttggagtccactgtggatgctttcacaggcttccgtcccatctctcatctg
cacttttctcatgtgacctcctccagtgtgaacatcacttggagtgatccatctccccca
gcagacagactcattcttaactacagccccagggatgaggaggaagagatgatggaggtc
tccctggatgccaccaagaggcatgctgtcctgatgggcctgcaaccagccacagagtat
attgtgaaccttgtggctgtccatggcacagtgacctctgagcccattgtgggctccatc
accacaggaattgatcccccaaaagacatcacaattagcaatgtgaccaaggactcagtg
atggtctcctggagccctcctgttgcatctttcgattactaccgagtatcatatcgaccc
acccaagtgggacgactagacagctcagtggtgcccaacactgtgacagaattcaccatc
accagactgaacccagctaccgaatacgaaatcagcctcaacagcgtgcggggcagggag
gaaagcgagcgcatctgtactcttgtgcacacagccatggacaaccctgtggatctgatt
gctaccaatatcactccaacagaagccctgctgcagtggaaggcaccagtgggtgaggtg
gagaactacgtcattgttcttacacactttgcagtcgctggagagaccatccttgttgac
ggagtcagtgaggaatttcggcttgttgacctgcttcctagcacccactatactgccacc
atgtatgccaccaatggacctctcaccagtggcaccatcagcaccaacttttctactctc
ctggaccctccggcaaacctgacagccagtgaagtcaccagacaaagtgccctgatctcc
tggcagcctcccagggcagagattgaaaattatgtcttgacctacaaatccaccgatgga
agccgcaaggagctgattgtggatgcagaagacacctggattcgactggagggcctgttg
gagaacacagactacacggtgctcctgcaggcagcacaggacaccacgtggagcagcatc
acctccaccgctttcaccacaggaggccgggtgttccctcatccccaagactgtgcccag
catttgatgaatggagacactttgagtggggtttaccccatcttcctcaatggggagctg
agccagaaattacaagtgtactgtgatatgaccaccgacgggggcggctggattgtattc
cagaggcggcagaatggccaaactgattttttccggaaatgggctgattaccgtgttggc
ttcgggaacgtggaggatgagttctggctggggctggacaatatacacaggatcacatcc
cagggccgctatgagctgcgcgtggacatgcgggatggccaagaggccgccttcgcctcc
tacgacaggttctctgtcgaggacagcagaaacctgtacaaactccgcataggaagctac
aacggcactgcgggggactccctcagctatcatcaaggacgccctttctccacagaggat
agagacaatgatgttgcagtgactaactgtgccatgtcgtacaagggagcatggtggtat
aagaactgccaccggaccaacctcaatgggaagtacggggagtccaggcacagtcagggc
atcaactggtaccattggaaaggccatgagttctccatcccctttgtggaaatgaagatg
cgcccctacaaccaccgtctcatggcagggagaaaacggcagtccttacagttctga

DBGET integrated database retrieval system