KEGG   Homo sapiens (human): 7148Help
Entry
7148              CDS       T01001                                 

Gene name
TNXB, EDS3, EDSCLL, EDSCLL1, HXBL, TENX, TN-X, TNX, TNXB1, TNXB2, TNXBS, VUR8, XB, XBS
Definition
(RefSeq) tenascin XB
  KO
K06252  tenascin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04512  ECM-receptor interaction
hsa05165  Human papillomavirus infection
hsa05206  MicroRNAs in cancer
Disease
H00802  Ehlers-Danlos syndrome
H01037  Vesicoureteral reflux
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    7148 (TNXB)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    7148 (TNXB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    7148 (TNXB)
 09160 Human Diseases
  09161 Cancers: Overview
   05206 MicroRNAs in cancer
    7148 (TNXB)
  09172 Infectious diseases: Viral
   05165 Human papillomavirus infection
    7148 (TNXB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    7148 (TNXB)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules
   7148 (TNXB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: fn3 Fibrinogen_C EGF_2 EGF_Tenascin DUF2369 hEGF
Motif
Other DBs
NCBI-GeneID: 7148
NCBI-ProteinID: NP_061978
OMIM: 600985
HGNC: 11976
Ensembl: ENSG00000168477
Vega: OTTHUMG00000031088
Pharos: P22105(Tbio)
UniProt: P22105 Q9Y464 O95680 O95681
Structure
PDB: 

Position
6p21.33-p21.32
AA seq 4242 aa AA seqDB search
MMPAQYALTSSLVLLVLLSTARAGPFSSRSNVTLPAPRPPPQPGGHTVGAGVGSPSSQLY
EHTVEGGEKQVVFTHRINLPPSTGCGCPPGTEPPVLASEVQALRVRLEILEELVKGLKEQ
CTGGCCPASAQAGTGQTDVRTLCSLHGVFDLSRCTCSCEPGWGGPTCSDPTDAEIPPSSP
PSASGSCPDDCNDQGRCVRGRCVCFPGYTGPSCGWPSCPGDCQGRGRCVQGVCVCRAGFS
GPDCSQRSCPRGCSQRGRCEGGRCVCDPGYTGDDCGMRSCPRGCSQRGRCENGRCVCNPG
YTGEDCGVRSCPRGCSQRGRCKDGRCVCDPGYTGEDCGTRSCPWDCGEGGRCVDGRCVCW
PGYTGEDCSTRTCPRDCRGRGRCEDGECICDTGYSGDDCGVRSCPGDCNQRGRCEDGRCV
CWPGYTGTDCGSRACPRDCRGRGRCENGVCVCNAGYSGEDCGVRSCPGDCRGRGRCESGR
CMCWPGYTGRDCGTRACPGDCRGRGRCVDGRCVCNPGFTGEDCGSRRCPGDCRGHGLCED
GVCVCDAGYSGEDCSTRSCPGGCRGRGQCLDGRCVCEDGYSGEDCGVRQCPNDCSQHGVC
QDGVCICWEGYVSEDCSIRTCPSNCHGRGRCEEGRCLCDPGYTGPTCATRMCPADCRGRG
RCVQGVCLCHVGYGGEDCGQEEPPASACPGGCGPRELCRAGQCVCVEGFRGPDCAIQTCP
GDCRGRGECHDGSCVCKDGYAGEDCGEEVPTIEGMRMHLLEETTVRTEWTPAPGPVDAYE
IQFIPTTEGASPPFTARVPSSASAYDQRGLAPGQEYQVTVRALRGTSWGLPASKTITTMI
DGPQDLRVVAVTPTTLELGWLRPQAEVDRFVVSYVSAGNQRVRLEVPPEADGTLLTDLMP
GVEYVVTVTAERGRAVSYPASVRANTGSSPLGLLGTTDEPPPSGPSTTQGAQAPLLQQRP
QELGELRVLGRDETGRLRVVWTAQPDTFAYFQLRMRVPEGPGAHEEVLPGDVRQALVPPP
PPGTPYELSLHGVPPGGKPSDPIIYQGIMDKDEEKPGKSSGPPRLGELTVTDRTSDSLLL
RWTVPEGEFDSFVIQYKDRDGQPQVVPVEGPQRSAVITSLDPGRKYKFVLYGFVGKKRHG
PLVAEAKILPQSDPSPGTPPHLGNLWVTDPTPDSLHLSWTVPEGQFDTFMVQYRDRDGRP
QVVPVEGPERSFVVSSLDPDHKYRFTLFGIANKKRYGPLTADGTTAPERKEEPPRPEFLE
QPLLGELTVTGVTPDSLRLSWTVAQGPFDSFMVQYKDAQGQPQAVPVAGDENEVTVPGLD
PDRKYKMNLYGLRGRQRVGPESVVAKTAPQEDVDETPSPTELGTEAPESPEEPLLGELTV
TGSSPDSLSLFWTVPQGSFDSFTVQYKDRDGRPRAVRVGGKESEVTVGGLEPGHKYKMHL
YGLHEGQRVGPVSAVGVTAPQQEETPPATESPLEPRLGELTVTDVTPNSVGLSWTVPEGQ
FDSFIVQYKDKDGQPQVVPVAADQREVTVYNLEPERKYKMNMYGLHDGQRMGPLSVVIVT
APLPPAPATEASKPPLEPRLGELTVTDITPDSVGLSWTVPEGEFDSFVVQYKDRDGQPQV
VPVAADQREVTIPDLEPSRKYKFLLFGIQDGKRRSPVSVEAKTVARGDASPGAPPRLGEL
WVTDPTPDSLRLSWTVPEGQFDSFVVQFKDKDGPQVVPVEGHERSVTVTPLDAGRKYRFL
LYGLLGKKRHGPLTADGTTEARSAMDDTGTKRPPKPRLGEELQVTTVTQNSVGLSWTVPE
GQFDSFVVQYKDRDGQPQVVPVEGSLREVSVPGLDPAHRYKLLLYGLHHGKRVGPISAVA
ITAGREETETETTAPTPPAPEPHLGELTVEEATSHTLHLSWMVTEGEFDSFEIQYTDRDG
QLQMVRIGGDRNDITLSGLESDHRYLVTLYGFSDGKHVGPVHVEALTVPEEEKPSEPPTA
TPEPPIKPRLGELTVTDATPDSLSLSWTVPEGQFDHFLVQYRNGDGQPKAVRVPGHEEGV
TISGLEPDHKYKMNLYGFHGGQRMGPVSVVGVTAAEEETPSPTEPSMEAPEPAEEPLLGE
LTVTGSSPDSLSLSWTVPQGRFDSFTVQYKDRDGRPQVVRVGGEESEVTVGGLEPGRKYK
MHLYGLHEGRRVGPVSAVGVTAPEEESPDAPLAKLRLGQMTVRDITSDSLSLSWTVPEGQ
FDHFLVQFKNGDGQPKAVRVPGHEDGVTISGLEPDHKYKMNLYGFHGGQRVGPVSAVGLT
APGKDEEMAPASTEPPTPEPPIKPRLEELTVTDATPDSLSLSWTVPEGQFDHFLVQYKNG
DGQPKATRVPGHEDRVTISGLEPDNKYKMNLYGFHGGQRVGPVSAIGVTAAEEETPSPTE
PSMEAPEPPEEPLLGELTVTGSSPDSLSLSWTVPQGRFDSFTVQYKDRDGRPQVVRVGGE
ESEVTVGGLEPGRKYKMHLYGLHEGRRVGPVSTVGVTAPQEDVDETPSPTEPGTEAPGPP
EEPLLGELTVTGSSPDSLSLSWTVPQGRFDSFTVQYKDRDGRPQAVRVGGQESKVTVRGL
EPGRKYKMHLYGLHEGRRLGPVSAVGVTEDEAETTQAVPTMTPEPPIKPRLGELTMTDAT
PDSLSLSWTVPEGQFDHFLVQYRNGDGQPKAVRVPGHEDGVTISGLEPDHKYKMNLYGFH
GGQRVGPISVIGVTAAEEETPSPTELSTEAPEPPEEPLLGELTVTGSSPDSLSLSWTIPQ
GHFDSFTVQYKDRDGRPQVMRVRGEESEVTVGGLEPGRKYKMHLYGLHEGRRVGPVSTVG
VTEDEAETTQAVPTTTPEPPNKPRLGELTVTDATPDSLSLSWMVPEGQFDHFLVQYRNGD
GQPKVVRVPGHEDGVTISGLEPDHKYKMNLYGFHGGQRVGPISVIGVTAAEEETPAPTEP
STEAPEPPEEPLLGELTVTGSSPDSLSLSWTIPQGRFDSFTVQYKDRDGRPQVVRVRGEE
SEVTVGGLEPGCKYKMHLYGLHEGQRVGPVSAVGVTAPKDEAETTQAVPTMTPEPPIKPR
LGELTVTDATPDSLSLSWMVPEGQFDHFLVQYRNGDGQPKAVRVPGHEDGVTISGLEPDH
KYKMNLYGFHGGQRVGPVSAIGVTEEETPSPTEPSTEAPEAPEEPLLGELTVTGSSPDSL
SLSWTVPQGRFDSFTVQYKDRDGQPQVVRVRGEESEVTVGGLEPGRKYKMHLYGLHEGQR
VGPVSTVGITAPLPTPLPVEPRLGELAVAAVTSDSVGLSWTVAQGPFDSFLVQYRDAQGQ
PQAVPVSGDLRAVAVSGLDPARKYKFLLFGLQNGKRHGPVPVEARTAPDTKPSPRLGELT
VTDATPDSVGLSWTVPEGEFDSFVVQYKDKDGRLQVVPVAANQREVTVQGLEPSRKYRFL
LYGLSGRKRLGPISADSTTAPLEKELPPHLGELTVAEETSSSLRLSWTVAQGPFDSFVVQ
YRDTDGQPRAVPVAADQRTVTVEDLEPGKKYKFLLYGLLGGKRLGPVSALGMTAPEEDTP
APELAPEAPEPPEEPRLGVLTVTDTTPDSMRLSWSVAQGPFDSFVVQYEDTNGQPQALLV
DGDQSKILISGLEPSTPYRFLLYGLHEGKRLGPLSAEGTTGLAPAGQTSEESRPRLSQLS
VTDVTTSSLRLNWEAPPGAFDSFLLRFGVPSPSTLEPHPRPLLQRELMVPGTRHSAVLRD
LRSGTLYSLTLYGLRGPHKADSIQGTARTLSPVLESPRDLQFSEIRETSAKVNWMPPPSR
ADSFKVSYQLADGGEPQSVQVDGQARTQKLQGLIPGARYEVTVVSVRGFEESEPLTGFLT
TVPDGPTQLRALNLTEGFAVLHWKPPQNPVDTYDVQVTAPGAPPLQAETPGSAVDYPLHD
LVLHTNYTATVRGLRGPNLTSPASITFTTGLEAPRDLEAKEVTPRTALLTWTEPPVRPAG
YLLSFHTPGGQNQEILLPGGITSHQLLGLFPSTSYNARLQAMWGQSLLPPVSTSFTTGGL
RIPFPRDCGEEMQNGAGASRTSTIFLNGNRERPLNVFCDMETDGGGWLVFQRRMDGQTDF
WRDWEDYAHGFGNISGEFWLGNEALHSLTQAGDYSMRVDLRAGDEAVFAQYDSFHVDSAA
EYYRLHLEGYHGTAGDSMSYHSGSVFSARDRDPNSLLISCAVSYRGAWWYRNCHYANLNG
LYGSTVDHQGVSWYHWKGFEFSVPFTEMKLRPRNFRSPAGGG
NT seq 12729 nt NT seq  +upstreamnt  +downstreamnt
atgatgccagcccagtatgctctaacctccagcctggttctcctggtgctgctgagcaca
gccagagcaggccccttctcttcacggtccaatgtgacactgccagccccccggccccct
ccccagccagggggccacacagtgggggctggagtgggaagcccctcttctcagctttac
gagcacacagtggaaggaggggagaagcaggtggtattcacccaccgcattaacctgccc
ccttccactggctgtggctgtcccccaggcaccgagcccccagtccttgcttcagaggta
caggccctgagggtccgtctagagatcctggaggagttggtgaaggggctcaaggaacag
tgcactgggggatgttgtcctgcctctgcccaagctggcacaggtcagacagatgtgcgg
accctctgcagtctccatggtgtgtttgatctgagccgctgcacctgttcctgtgagcca
ggctggggtgggcccacctgctcagaccccacagatgctgagatccctccctcttcccca
ccctcagcctcggggtcctgcccagatgactgcaatgatcagggtcgctgtgtccgtggt
cgttgcgtgtgctttcccggctacactggccccagctgtggctggccatcctgtcccggg
gactgccaaggccgtgggcgctgcgtgcagggcgtgtgtgtgtgccgggcaggcttctca
ggccccgactgcagccagcgctcctgccctcgaggttgcagccagaggggacgctgtgag
ggtgggcgctgcgtgtgtgacccaggctacactggtgacgactgtggcatgaggagctgc
cctcgcggttgcagtcagagggggcgctgtgagaatgggcgctgcgtgtgtaaccccggc
tacactggcgaggactgtggggtgaggagctgccctcggggctgcagccagcggggacgc
tgcaaggacgggcgctgcgtgtgtgaccccggctacactggcgaggactgtggtacgcgg
agctgcccctgggactgtggcgagggcgggcgctgcgtggacggccgctgcgtgtgctgg
cccgggtacacaggcgaggactgcagcacgcggacatgtccgagggactgccggggccgc
gggcgctgcgaggacggcgaatgcatttgcgacacgggctacagcggggacgactgcggc
gtgcgcagctgccctggcgactgcaaccaaaggggccgctgcgaggacggccgctgcgtg
tgctggccggggtacactggaaccgattgcggctcgcgcgcctgcccacgcgactgtaga
ggtcgcgggcgctgcgagaacggcgtgtgtgtttgcaatgcgggctacagcggcgaggac
tgcggtgtgcgcagctgtcctggggactgtcgtggccggggccgctgtgagagtggccgc
tgcatgtgttggccggggtacacaggccgggactgcggcacgcgcgcctgtcctggcgac
tgtcgcgggcgcgggcgctgcgtggatggccgctgcgtgtgcaacccgggcttcaccggt
gaggactgtgggagccgtcgctgtcccggggactgccgtgggcacggcctttgcgaggat
ggcgtgtgcgtgtgtgacgcaggctactcaggggaagactgcagcacgcgcagctgcccc
gggggctgccgaggccgcggccagtgcctagatgggcggtgtgtgtgcgaggacggctac
tctggcgaggattgcggtgtgaggcagtgcccgaatgactgcagccagcacggcgtgtgc
caggacggtgtgtgcatctgttgggaaggctacgtgagtgaggactgcagcatccgcacc
tgcccctccaactgccacgggaggggccgctgtgaggaagggcgctgcctgtgcgaccca
ggctacaccggccctacctgtgccacccgcatgtgcccggctgactgccggggacgtggg
cggtgtgtgcaaggagtgtgcctgtgccacgtgggctatggcggtgaggactgcgggcag
gaagagcctccagccagcgcctgccctggaggctgcgggccccgggaactgtgccgggca
ggccagtgtgtgtgtgtagagggcttccgaggccctgactgtgccatccagacatgccca
ggggactgccgtggccgaggagagtgtcacgatggcagctgtgtctgcaaagatgggtat
gctggcgaagactgcggagaagaggtgccaaccattgagggcatgaggatgcatctcttg
gaggagacaacagttcggacagagtggaccccggctcctggccccgtggatgcctatgaa
attcagttcatccccacgacagagggggcgagccccccattcacagcacgggttccaagc
tctgcctcagcctatgaccagagaggactggcccctggacaggagtaccaggtcactgtc
cgagcccttcgagggaccagctggggccttcctgcctccaagaccatcaccaccatgatc
gatgggccccaggacctccgagtggtggctgtgacaccgacaacactggagcttggctgg
ctgcgtccccaggctgaggtggaccgatttgtggtgtcctacgtcagtgccggcaaccag
agggtgaggctggaagtgccccctgaagcagacgggacgctgctgactgacctgatgcca
ggcgtagaatatgtggtgactgtcacagcggagcggggccgggcagtcagctacccagct
tctgtcagggccaacacagggtcctcacccttgggcctcttggggactaccgatgagcct
cctccctcaggcccctcgacgacgcaaggggcccaggctcctctcctgcagcagcgcccc
caggagctgggagagttgagggtgctgggcagagatgagacagggcgcctccgtgtggtc
tggaccgcccagcctgacacctttgcctacttccaactgcgcatgcgggtgcccgagggg
ccgggggcacatgaggaagtgctgccaggggacgtccgccaggctctggtgcctccaccc
cctcctggaaccccgtatgagctgtcacttcatggggtccctcctgggggcaagccctct
gaccccatcatctaccaaggcattatggacaaggatgaggagaagcctgggaagtcctca
ggcccaccacgcctgggtgagctgacggtgacagacaggacctccgactccttgctcctg
cgctggacggtccccgagggcgagtttgactccttcgtgatccagtacaaagacagggac
gggcagccccaggtggtgcccgtggaaggaccccagcgctcggccgtcatcacctccctg
gatcctggccgcaagtacaaatttgtcctgtatgggtttgttggcaagaagaggcatggt
ccgctggtggctgaagccaagatcttgcctcagagtgacccaagtccagggactccaccc
cacctgggaaacctgtgggtgacagaccctaccccagattcactgcacctctcctggact
gtccctgagggccagtttgacaccttcatggtccagtacagggacagggatggacggccc
caggtggtacctgtggaagggcccgagcgttcatttgttgtctcctcactggaccctgac
cacaagtacagattcactctgtttggaattgcgaacaagaagcggtatggccccctcacg
gccgatggcaccactgctccagagaggaaagaggagcccccccgccctgagttcctggag
cagcccctcctgggggaactgacagtgaccggcgtgaccccagactccttgcgtctctca
tggacagtggcccagggccccttcgactcattcatggtccagtacaaggatgcacagggg
cagccccaggcagtgcctgttgcgggggatgagaatgaggttactgtccccggcctggat
cccgaccggaagtataagatgaacctctacgggcttcgtggcaggcagcgtgtggggccc
gagtctgtggtggccaagactgctcctcaggaggatgtggacgagacccccagccccaca
gaactgggcacggaggccccggagtcccccgaggagccgctcctgggggagctgacagtg
acaggatcctcccctgattcgctgagcctcttctggaccgtcccccagggcagcttcgac
tctttcaccgtgcagtacaaggacagggatgggcggccccgggcggtgcgtgttgggggc
aaggagagtgaggtcaccgtgggaggcctagagcccgggcacaagtacaagatgcacctg
tacggcctccacgaggggcagcgcgtgggcccggtgtccgccgtgggcgtgacagcccca
caacaagaagagacccctccagccactgagtccccgctggagccacgcctaggagagctg
acagtgacagatgtgacccccaactctgtgggcctctcctggacagtccccgagggccag
tttgactccttcatagtccagtacaaggacaaggacgggcagccccaggtggtgccggtg
gcggcagaccagcgagaggtcacagtctacaacctggagcctgagagaaaatataagatg
aacatgtatggactacatgatgggcaacgcatgggccccctgtctgtggtcatcgtgacg
gctcccctcccaccagccccagccacagaggcctccaagcctcccctggagccacgccta
ggggagctgacagtgacggatataacccctgactctgtgggcctctcatggacagtccct
gagggtgaattcgactcctttgtggttcagtacaaggacagggacgggcagccccaggtg
gtgcccgtggctgcagatcagcgggaggtcactatccctgacctggaaccctcccgcaag
tacaagttcctgctctttgggatccaggatgggaaacgacgcagcccagtctctgtggag
gcaaagacggttgcccgaggtgacgccagcccaggggccccaccccgccttggggagctg
tgggtgacagaccccaccccagactcactgcgcctctcctggacggttcctgagggccag
ttcgactcttttgtggtccagttcaaggacaaagacgggccccaggtggtgcccgtggag
ggccatgagcgctctgtcactgtcacccctctggatgccggccgcaagtacagattcctc
ctctatggcctcctgggcaagaagcgccatggccctctcactgccgacggcaccacggaa
gcccggagtgctatggatgatactggaacaaagcgtcccccaaaaccccgtctgggggag
gagctgcaggtgaccaccgtgacccagaactccgtgggcctctcctggacagtccctgag
ggccagtttgactcctttgtggtccagtacaaagacagggacgggcagccccaggtggtg
cccgtggagggcagcctcagggaggtcagcgtgccgggcctggaccctgcccacaggtac
aagctgctgctctacgggctgcaccacggcaagcgtgtgggccccatctcggccgtcgcc
attactgccggcagggaagaaacggaaactgagaccacggccccgacccctccagcgcct
gagccccacctcggggagttgacagtggaggaggccacgtcacacaccctgcatctctcc
tggatggtgactgagggagaatttgactccttcgaaatccagtacacagatagagacggg
caactccaaatggtccgcataggaggtgaccggaatgacatcaccctctctggcctggaa
tccgaccacagatacctggtgaccctgtatggtttcagtgatgggaagcatgtaggtcct
gtccatgtcgaggccctgacagtcccggaggaggagaagccttcagaacctcccaccgca
acccccgagccccccatcaagcctcgcctgggggagctgaccgtgacagatgccacccct
gactccctcagcctgtcctggacagttcccgagggacagtttgaccacttcctggtccag
tacaggaatggagatgggcagcccaaggcagtgagggtgccagggcacgaggaaggggtc
accatctcgggcctggagccagaccataaatacaagatgaacctgtacggcttccacggt
ggccagcgcatgggccctgtgtctgtcgtcggggtgacagctgcagaggaagagaccccc
agccccacagaacccagcatggaggccccggagcccgctgaggagccgctcctgggggag
ctaacagtgacaggatcctcccctgactcgctgagcctctcctggaccgtcccccagggc
cgcttcgactccttcaccgtgcagtacaaggacagggacgggcggccccaggtggtgcgt
gttgggggcgaggagagtgaagtcaccgtggggggcctggagcctgggcgcaagtacaag
atgcacctgtacggcctccacgaggggcggcgcgtgggcccagtgtctgctgtgggcgtc
acggcccccgaagaggagtcccctgatgctcctcttgcaaagctgcgcctagggcagatg
acagtgagagacatcacctccgactccctcagcctctcctggacagtccccgagggccag
tttgaccatttcttggtccagtttaagaatggggacgggcagcccaaggcggtgcgggtg
ccgggacacgaggatggggtcaccatctcgggcctggagccagaccacaagtacaagatg
aacctgtacggcttccacggtggccagcgcgtgggccccgtgtctgctgttggtttaact
gccccaggaaaggatgaagaaatggccccagcctcgacagaacctcccacccctgaaccc
cccatcaagcctcgcctggaggagctgaccgtgacagatgcgacccctgactccctcagc
ctgtcctggacggttcccgagggacagtttgaccacttcctggtccagtacaagaatggg
gatgggcagcccaaggcaacacgggtgccaggacatgaggacagggtcaccatctccggc
ctggagccagacaacaagtacaagatgaacctgtacggcttccacggtggccagcgtgtg
ggccccgtgtctgccatcggggtgacagctgcagaggaagagacccccagccccacagaa
cccagcatggaggccccggagccccctgaggagccgctcctgggggagctaacagtgaca
ggatcctcccctgactcgctgagcctctcctggaccgtcccccagggccgcttcgactcc
ttcaccgtgcagtacaaggacagggacgggcggccccaggtggtgcgtgttgggggcgag
gagagcgaggtcaccgtggggggcctggagcctgggcgcaaatacaagatgcacctgtat
ggcctccacgaggggcggcgcgtgggcccggtgtccaccgtgggcgtgactgccccacaa
gaggatgtggacgagacccccagccctacagaaccaggcacagaggccccagggcccccc
gaggagcctctcctgggggagctgacagtgacaggatcctcccctgactcgctgagcctt
tcctggaccgtcccccagggccgctttgactccttcaccgtgcagtacaaggacagggac
gggcggccccaggcggtgcgtgttgggggccaggagagcaaggtcactgtgaggggcctg
gagcctgggcgcaagtacaagatgcacctgtacggcctccacgaggggcggcgcctgggc
ccggtgtctgccgtgggcgtcacagaggatgaagccgagaccacccaagcagtgcctacc
atgacccctgagccccccatcaagcctcgcctgggggagctgaccatgacagatgccacc
cctgactccctcagcctgtcctggacggttcccgagggccagtttgaccacttcctggtc
cagtacaggaatggggatgggcagcccaaggcggtgcgggtgccggggcacgaggacggg
gtcaccatctcaggcctggagccagaccataaatacaagatgaacctgtacggcttccac
ggtggccagcgcgtgggccccatctctgtcattggggtgacggctgcagaggaagagacc
cccagccccacggaactcagcactgaggccccggagccccctgaggagccgctcctgggg
gagctgacagtgacaggatcctcccctgactcgctgagcctctcctggaccatcccccag
ggccacttcgactccttcaccgtgcagtacaaggacagggacgggcggccccaggtgatg
cgtgtcaggggcgaggagagcgaggtcaccgtggggggcctggagcccgggcgcaaatac
aagatgcacctgtacggcctccacgaggggcggcgtgtgggcccggtgtccaccgtgggt
gtgacagaggatgaagcagagaccacccaagcagtgcccaccacaacccctgagcccccc
aacaagcctcgcctcggggagctgaccgtgacagatgccacccctgactccctcagcctg
tcctggatggtccccgagggccagtttgaccacttcctggtccagtacaggaatggggat
gggcagcccaaggtggtgcgggtgccggggcacgaggacggggtcaccatctcaggcctg
gagccagaccacaagtacaagatgaacctgtacggcttccacggtggccagcgcgtgggc
cccatctctgtcattggggtgacagctgcagaggaagaaactcccgcccccacagaaccc
agcacggaggccccggagccccctgaggagccgctcctgggggagctgacagtgacagga
tcctcccctgactcgctgagcctctcctggaccatcccccagggccgcttcgactccttc
actgtgcagtacaaggacagggacgggcggccccaggtggtgcgtgtcaggggcgaggag
agcgaggtcaccgtggggggcctggagcccgggtgcaaatacaagatgcacctgtacggc
ctccacgaggggcagcgcgtgggcccagtgtccgctgtgggtgtgacagctccaaaggat
gaagccgagaccacccaagcagtgcctaccatgacccctgagccccccatcaagcctcgc
ctgggggagctgaccgtgacagatgccacccccgactccctcagcctgtcctggatggtt
cccgagggccagtttgaccacttcctggtccagtacaggaatggggatgggcagcccaag
gcggtgcgggtgccggggcacgaggacggggtcaccatctcaggcctggagccagaccat
aaatacaagatgaacctgtacggcttccacggtggccagcgcgtaggccctgtgtctgcc
attggggtgacggaggaagagacccccagccccacagaacccagcactgaggccccggag
gcccctgaggagccgctcctgggggagttgacagtgacaggatcctcccctgactcgctg
agcctctcctggaccgtcccccagggccgcttcgactccttcaccgtgcagtacaaggac
agggacgggcagccccaggtggtgcgtgtcaggggcgaggagagcgaggtcaccgtgggg
ggcctggagcccgggcgcaaatacaagatgcatctgtacggcctccacgaggggcagcgc
gtgggcccagtgtccaccgtgggcatcacggcgcccctgcccacaccactgccggtggag
ccccgcctgggggagctggcggtggcggccgtgacctcggactcagtgggcctctcatgg
acggtggcccagggcccctttgactccttcctggtacagtacagggacgcgcaggggcag
ccccaggcagtgcctgtgagcggagacctccgagcggtcgccgtctcggggctggacccg
gcccgcaagtacaagttcctgctctttggactccagaatgggaaacgccacggcccagtc
cctgtggaggccaggaccgccccagacaccaaaccgtctccccgcctgggggagctgact
gtgacagatgcgacccctgactccgtgggcctctcgtggacggtccctgagggcgaattc
gactccttcgtggtccagtacaaggataaggatggtcggctccaggtggtgccggtggca
gccaaccagcgggaggtcacagtccagggcctggagcccagtaggaaatacaggttcctg
ctctatggtctgtcaggcaggaaacgactgggccccatctctgctgacagcaccacagct
cccctggagaaggagctacctccccacctgggggaactgaccgtggctgaggagacctcc
agctctctgcgcctgtcctggacggtagcccagggcccctttgactccttcgtggtccag
tacagggacacggacgggcagcccagggcagtgcctgtggccgcagaccagcgcacagtc
accgtagaggacctggagcctggcaagaaatacaagtttctgctctacgggctccttggg
ggaaagcgcctgggcccggtctctgccctgggaatgacagccccagaagaggacacacca
gccccagagttagccccagaggcccctgagcctcctgaagagccccgcctaggagtgctg
accgtgaccgacacaaccccagactccatgcgcctctcgtggagcgtggcccagggcccc
tttgattccttcgtggtccagtatgaggacacgaacgggcagccccaggccttgctcgtg
gacggcgaccagagcaagatcctcatctcaggcctggagcccagcaccccctacaggttc
ctcctctatggcctccatgaagggaagcgcctggggcccctctcagctgagggcaccaca
gggctggctcctgctggtcagacctcagaggagtcaaggccccgcctgtcccagctgtct
gtgactgacgtgaccaccagttcactgaggctcaactgggaggccccaccgggggccttc
gactccttcctgctccgctttggggttccatcaccaagcactctggagccgcatccgcgt
ccactgctgcagcgcgagctgatggtgccggggacgcggcactcggccgtgctccgggac
ctgcgttccgggactctgtacagcctgacactgtatgggctgcgaggaccccacaaggcc
gacagcatccagggaaccgcccgcaccctcagcccagttctggagagcccccgtgacctc
caattcagtgaaatcagggagacctcagccaaggtcaactggatgcccccaccatcccgg
gcggacagcttcaaagtctcctaccagctggcggacggaggggagcctcagagtgtgcag
gtggatggccaggcccggacccagaaactccaggggctgatcccaggcgctcgctatgag
gtgaccgtggtctcggtccgaggctttgaggagagtgagcctctcacaggcttcctcacc
acggttcctgacggtcccacacagttgcgtgcactgaacttgaccgagggattcgccgtg
ctgcactggaagcccccccagaatcctgtggacacctatgacgtccaggtcacagcccct
ggggccccgcctctgcaggcggagaccccaggcagcgcggtggactaccccctgcatgac
cttgtcctccacaccaactacaccgccacagtgcgtggcctgcggggccccaacctcact
tccccagccagcatcaccttcaccacagggctagaggcccctcgggacttggaggccaag
gaagtgaccccccgcaccgccctgctcacttggactgagcccccagtccggcccgcaggc
tacctgctcagcttccacacccctggtggacagaaccaggagatcctgctcccaggaggg
atcacatctcaccagctccttggcctctttccctccacctcctacaatgcacggctccag
gccatgtggggccagagcctcctgccgcccgtgtccacctctttcaccacgggtgggctg
cggatccccttccccagggactgcggggaggagatgcagaacggagccggtgcctccagg
accagcaccatcttcctcaacggcaaccgcgagcggcccctgaacgtgttttgcgacatg
gagactgatgggggcggctggctggtgttccagcgccgcatggatggacagacagacttc
tggagggactgggaggactatgcccatggttttgggaacatctctggagagttctggctg
ggcaatgaggccctgcacagcctgacacaggcaggtgactactccatgcgcgtggacctg
cgggctggggacgaggctgtgttcgcccagtacgactccttccacgtagactcggctgcg
gagtactaccgcctccacttggagggctaccacggcaccgcaggggactccatgagctac
cacagcggcagtgtcttctctgcccgtgatcgggaccccaacagcttgctcatctcctgc
gctgtctcctaccgaggggcctggtggtacaggaactgccactacgccaacctcaacggg
ctctacgggagcacagtggaccatcagggagtgagctggtaccactggaagggcttcgag
ttctcggtgcccttcacggaaatgaagctgagaccaagaaactttcgctccccagcgggg
ggaggctga

DBGET integrated database retrieval system