KEGG   Homo sapiens (human): 7148Help
Entry
7148              CDS       T01001                                 

Gene name
TNXB, EDS3, EDSCLL, HXBL, TENX, TN-X, TNX, TNXB1, TNXB2, TNXBS, VUR8, XB, XBS
Definition
(RefSeq) tenascin XB
  KO
K06252  tenascin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04512  ECM-receptor interaction
hsa05165  Human papillomavirus infection
hsa05206  MicroRNAs in cancer
Disease
H00802  Ehlers-Danlos syndrome (EDS)
H01037  Vesicoureteral reflux
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    7148 (TNXB)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    7148 (TNXB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    7148 (TNXB)
 09160 Human Diseases
  09161 Cancers
   05206 MicroRNAs in cancer
    7148 (TNXB)
  09167 Infectious diseases
   05165 Human papillomavirus infection
    7148 (TNXB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    7148 (TNXB)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules
   7148 (TNXB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: fn3 Fibrinogen_C EGF_2 DUF2369 hEGF
Motif
Other DBs
NCBI-GeneID: 7148
NCBI-ProteinID: NP_061978
OMIM: 600985
HGNC: 11976
Ensembl: ENSG00000168477
Vega: OTTHUMG00000031088
Pharos: P22105(Tbio)
UniProt: P22105 O95680 Q9Y464 O95681
Structure
PDB: 

Position
6p21.33-p21.32
AA seq 4242 aa AA seqDB search
MMPAQYALTSSLVLLVLLSTARAGPFSSRSNVTLPAPRPPPQPGGHTVGAGVGSPSSQLY
EHTVEGGEKQVVFTHRINLPPSTGCGCPPGTEPPVLASEVQALRVRLEILEELVKGLKEQ
CTGGCCPASAQAGTGQTDVRTLCSLHGVFDLSRCTCSCEPGWGGPTCSDPTDAEIPPSSP
PSASGSCPDDCNDQGRCVRGRCVCFPGYTGPSCGWPSCPGDCQGRGRCVQGVCVCRAGFS
GPDCSQRSCPRGCSQRGRCEGGRCVCDPGYTGDDCGMRSCPRGCSQRGRCENGRCVCNPG
YTGEDCGVRSCPRGCSQRGRCKDGRCVCDPGYTGEDCGTRSCPWDCGEGGRCVDGRCVCW
PGYTGEDCSTRTCPRDCRGRGRCEDGECICDTGYSGDDCGVRSCPGDCNQRGRCEDGRCV
CWPGYTGTDCGSRACPRDCRGRGRCENGVCVCNAGYSGEDCGVRSCPGDCRGRGRCESGR
CMCWPGYTGRDCGTRACPGDCRGRGRCVDGRCVCNPGFTGEDCGSRRCPGDCRGHGLCED
GVCVCDAGYSGEDCSTRSCPGGCRGRGQCLDGRCVCEDGYSGEDCGVRQCPNDCSQHGVC
QDGVCICWEGYVSEDCSIRTCPSNCHGRGRCEEGRCLCDPGYTGPTCATRMCPADCRGRG
RCVQGVCLCHVGYGGEDCGQEEPPASACPGGCGPRELCRAGQCVCVEGFRGPDCAIQTCP
GDCRGRGECHDGSCVCKDGYAGEDCGEEVPTIEGMRMHLLEETTVRTEWTPAPGPVDAYE
IQFIPTTEGASPPFTARVPSSASAYDQRGLAPGQEYQVTVRALRGTSWGLPASKTITTMI
DGPQDLRVVAVTPTTLELGWLRPQAEVDRFVVSYVSAGNQRVRLEVPPEADGTLLTDLMP
GVEYVVTVTAERGRAVSYPASVRANTGSSPLGLLGTTDEPPPSGPSTTQGAQAPLLQQRP
QELGELRVLGRDETGRLRVVWTAQPDTFAYFQLRMRVPEGPGAHEEVLPGDVRQALVPPP
PPGTPYELSLHGVPPGGKPSDPIIYQGIMDKDEEKPGKSSGPPRLGELTVTDRTSDSLLL
RWTVPEGEFDSFVIQYKDRDGQPQVVPVEGPQRSAVITSLDPGRKYKFVLYGFVGKKRHG
PLVAEAKILPQSDPSPGTPPHLGNLWVTDPTPDSLHLSWTVPEGQFDTFMVQYRDRDGRP
QVVPVEGPERSFVVSSLDPDHKYRFTLFGIANKKRYGPLTADGTTAPERKEEPPRPEFLE
QPLLGELTVTGVTPDSLRLSWTVAQGPFDSFMVQYKDAQGQPQAVPVAGDENEVTVPGLD
PDRKYKMNLYGLRGRQRVGPESVVAKTAPQEDVDETPSPTELGTEAPESPEEPLLGELTV
TGSSPDSLSLFWTVPQGSFDSFTVQYKDRDGRPRAVRVGGKESEVTVGGLEPGHKYKMHL
YGLHEGQRVGPVSAVGVTAPQQEETPPATESPLEPRLGELTVTDVTPNSVGLSWTVPEGQ
FDSFIVQYKDKDGQPQVVPVAADQREVTVYNLEPERKYKMNMYGLHDGQRMGPLSVVIVT
APLPPAPATEASKPPLEPRLGELTVTDITPDSVGLSWTVPEGEFDSFVVQYKDRDGQPQV
VPVAADQREVTIPDLEPSRKYKFLLFGIQDGKRRSPVSVEAKTVARGDASPGAPPRLGEL
WVTDPTPDSLRLSWTVPEGQFDSFVVQFKDKDGPQVVPVEGHERSVTVTPLDAGRKYRFL
LYGLLGKKRHGPLTADGTTEARSAMDDTGTKRPPKPRLGEELQVTTVTQNSVGLSWTVPE
GQFDSFVVQYKDRDGQPQVVPVEGSLREVSVPGLDPAHRYKLLLYGLHHGKRVGPISAVA
ITAGREETETETTAPTPPAPEPHLGELTVEEATSHTLHLSWMVTEGEFDSFEIQYTDRDG
QLQMVRIGGDRNDITLSGLESDHRYLVTLYGFSDGKHVGPVHVEALTVPEEEKPSEPPTA
TPEPPIKPRLGELTVTDATPDSLSLSWTVPEGQFDHFLVQYRNGDGQPKAVRVPGHEEGV
TISGLEPDHKYKMNLYGFHGGQRMGPVSVVGVTAAEEETPSPTEPSMEAPEPAEEPLLGE
LTVTGSSPDSLSLSWTVPQGRFDSFTVQYKDRDGRPQVVRVGGEESEVTVGGLEPGRKYK
MHLYGLHEGRRVGPVSAVGVTAPEEESPDAPLAKLRLGQMTVRDITSDSLSLSWTVPEGQ
FDHFLVQFKNGDGQPKAVRVPGHEDGVTISGLEPDHKYKMNLYGFHGGQRVGPVSAVGLT
APGKDEEMAPASTEPPTPEPPIKPRLEELTVTDATPDSLSLSWTVPEGQFDHFLVQYKNG
DGQPKATRVPGHEDRVTISGLEPDNKYKMNLYGFHGGQRVGPVSAIGVTAAEEETPSPTE
PSMEAPEPPEEPLLGELTVTGSSPDSLSLSWTVPQGRFDSFTVQYKDRDGRPQVVRVGGE
ESEVTVGGLEPGRKYKMHLYGLHEGRRVGPVSTVGVTAPQEDVDETPSPTEPGTEAPGPP
EEPLLGELTVTGSSPDSLSLSWTVPQGRFDSFTVQYKDRDGRPQAVRVGGQESKVTVRGL
EPGRKYKMHLYGLHEGRRLGPVSAVGVTEDEAETTQAVPTMTPEPPIKPRLGELTMTDAT
PDSLSLSWTVPEGQFDHFLVQYRNGDGQPKAVRVPGHEDGVTISGLEPDHKYKMNLYGFH
GGQRVGPISVIGVTAAEEETPSPTELSTEAPEPPEEPLLGELTVTGSSPDSLSLSWTIPQ
GHFDSFTVQYKDRDGRPQVMRVRGEESEVTVGGLEPGRKYKMHLYGLHEGRRVGPVSTVG
VTEDEAETTQAVPTTTPEPPNKPRLGELTVTDATPDSLSLSWMVPEGQFDHFLVQYRNGD
GQPKVVRVPGHEDGVTISGLEPDHKYKMNLYGFHGGQRVGPISVIGVTAAEEETPAPTEP
STEAPEPPEEPLLGELTVTGSSPDSLSLSWTIPQGRFDSFTVQYKDRDGRPQVVRVRGEE
SEVTVGGLEPGCKYKMHLYGLHEGQRVGPVSAVGVTAPKDEAETTQAVPTMTPEPPIKPR
LGELTVTDATPDSLSLSWMVPEGQFDHFLVQYRNGDGQPKAVRVPGHEDGVTISGLEPDH
KYKMNLYGFHGGQRVGPVSAIGVTEEETPSPTEPSTEAPEAPEEPLLGELTVTGSSPDSL
SLSWTVPQGRFDSFTVQYKDRDGQPQVVRVRGEESEVTVGGLEPGRKYKMHLYGLHEGQR
VGPVSTVGITAPLPTPLPVEPRLGELAVAAVTSDSVGLSWTVAQGPFDSFLVQYRDAQGQ
PQAVPVSGDLRAVAVSGLDPARKYKFLLFGLQNGKRHGPVPVEARTAPDTKPSPRLGELT
VTDATPDSVGLSWTVPEGEFDSFVVQYKDKDGRLQVVPVAANQREVTVQGLEPSRKYRFL
LYGLSGRKRLGPISADSTTAPLEKELPPHLGELTVAEETSSSLRLSWTVAQGPFDSFVVQ
YRDTDGQPRAVPVAADQRTVTVEDLEPGKKYKFLLYGLLGGKRLGPVSALGMTAPEEDTP
APELAPEAPEPPEEPRLGVLTVTDTTPDSMRLSWSVAQGPFDSFVVQYEDTNGQPQALLV
DGDQSKILISGLEPSTPYRFLLYGLHEGKRLGPLSAEGTTGLAPAGQTSEESRPRLSQLS
VTDVTTSSLRLNWEAPPGAFDSFLLRFGVPSPSTLEPHPRPLLQRELMVPGTRHSAVLRD
LRSGTLYSLTLYGLRGPHKADSIQGTARTLSPVLESPRDLQFSEIRETSAKVNWMPPPSR
ADSFKVSYQLADGGEPQSVQVDGQARTQKLQGLIPGARYEVTVVSVRGFEESEPLTGFLT
TVPDGPTQLRALNLTEGFAVLHWKPPQNPVDTYDVQVTAPGAPPLQAETPGSAVDYPLHD
LVLHTNYTATVRGLRGPNLTSPASITFTTGLEAPRDLEAKEVTPRTALLTWTEPPVRPAG
YLLSFHTPGGQNQEILLPGGITSHQLLGLFPSTSYNARLQAMWGQSLLPPVSTSFTTGGL
RIPFPRDCGEEMQNGAGASRTSTIFLNGNRERPLNVFCDMETDGGGWLVFQRRMDGQTDF
WRDWEDYAHGFGNISGEFWLGNEALHSLTQAGDYSMRVDLRAGDEAVFAQYDSFHVDSAA
EYYRLHLEGYHGTAGDSMSYHSGSVFSARDRDPNSLLISCAVSYRGAWWYRNCHYANLNG
LYGSTVDHQGVSWYHWKGFEFSVPFTEMKLRPRNFRSPAGGG
NT seq 12729 nt NT seq  +upstreamnt  +downstreamnt
atgatgccagcccagtatgctctaacctccagcctggttctcctggtgctgctgagcaca
gccagagcaggccccttctcttcacggtccaatgtgacactgccagccccccggccccct
ccccagccagggggccacacagtgggggctggagtgggaagcccctcttctcagctttac
gagcacacagtggaaggaggggagaagcaggtggtattcacccaccgcattaacctgccc
ccttccactggctgtggctgtcccccaggcaccgagcccccagtccttgcttcagaggta
caggccctgagggtccgtctagagatcctggaggagttggtgaaggggctcaaggaacag
tgcactgggggatgttgtcctgcctctgcccaagctggcacaggtcagacagatgtgcgg
accctctgcagtctccatggtgtgtttgatctgagccgctgcacctgttcctgtgagcca
ggctggggtgggcccacctgctcagaccccacagatgctgagatccctccctcttcccca
ccctcagcctcggggtcctgcccagatgactgcaatgatcagggtcgctgtgtccgtggt
cgttgcgtgtgctttcccggctacactggccccagctgtggctggccatcctgtcccggg
gactgccaaggccgtgggcgctgcgtgcagggcgtgtgtgtgtgccgggcaggcttctca
ggccccgactgcagccagcgctcctgccctcgaggttgcagccagaggggacgctgtgag
ggtgggcgctgcgtgtgtgacccaggctacactggtgacgactgtggcatgaggagctgc
cctcgcggttgcagtcagagggggcgctgtgagaatgggcgctgcgtgtgtaaccccggc
tacactggcgaggactgtggggtgaggagctgccctcggggctgcagccagcggggacgc
tgcaaggacgggcgctgcgtgtgtgaccccggctacactggcgaggactgtggtacgcgg
agctgcccctgggactgtggcgagggcgggcgctgcgtggacggccgctgcgtgtgctgg
cccgggtacacaggcgaggactgcagcacgcggacatgtccgagggactgccggggccgc
gggcgctgcgaggacggcgaatgcatttgcgacacgggctacagcggggacgactgcggc
gtgcgcagctgccctggcgactgcaaccaaaggggccgctgcgaggacggccgctgcgtg
tgctggccggggtacactggaaccgattgcggctcgcgcgcctgcccacgcgactgtaga
ggtcgcgggcgctgcgagaacggcgtgtgtgtttgcaatgcgggctacagcggcgaggac
tgcggtgtgcgcagctgtcctggggactgtcgtggccggggccgctgtgagagtggccgc
tgcatgtgttggccggggtacacaggccgggactgcggcacgcgcgcctgtcctggcgac
tgtcgcgggcgcgggcgctgcgtggatggccgctgcgtgtgcaacccgggcttcaccggt
gaggactgtgggagccgtcgctgtcccggggactgccgtgggcacggcctttgcgaggat
ggcgtgtgcgtgtgtgacgcaggctactcaggggaagactgcagcacgcgcagctgcccc
gggggctgccgaggccgcggccagtgcctagatgggcggtgtgtgtgcgaggacggctac
tctggcgaggattgcggtgtgaggcagtgcccgaatgactgcagccagcacggcgtgtgc
caggacggtgtgtgcatctgttgggaaggctacgtgagtgaggactgcagcatccgcacc
tgcccctccaactgccacgggaggggccgctgtgaggaagggcgctgcctgtgcgaccca
ggctacaccggccctacctgtgccacccgcatgtgcccggctgactgccggggacgtggg
cggtgtgtgcaaggagtgtgcctgtgccacgtgggctatggcggtgaggactgcgggcag
gaagagcctccagccagcgcctgccctggaggctgcgggccccgggaactgtgccgggca
ggccagtgtgtgtgtgtagagggcttccgaggccctgactgtgccatccagacatgccca
ggggactgccgtggccgaggagagtgtcacgatggcagctgtgtctgcaaagatgggtat
gctggcgaagactgcggagaagaggtgccaaccattgagggcatgaggatgcatctcttg
gaggagacaacagttcggacagagtggaccccggctcctggccccgtggatgcctatgaa
attcagttcatccccacgacagagggggcgagccccccattcacagcacgggttccaagc
tctgcctcagcctatgaccagagaggactggcccctggacaggagtaccaggtcactgtc
cgagcccttcgagggaccagctggggccttcctgcctccaagaccatcaccaccatgatc
gatgggccccaggacctccgagtggtggctgtgacaccgacaacactggagcttggctgg
ctgcgtccccaggctgaggtggaccgatttgtggtgtcctacgtcagtgccggcaaccag
agggtgaggctggaagtgccccctgaagcagacgggacgctgctgactgacctgatgcca
ggcgtagaatatgtggtgactgtcacagcggagcggggccgggcagtcagctacccagct
tctgtcagggccaacacagggtcctcacccttgggcctcttggggactaccgatgagcct
cctccctcaggcccctcgacgacgcaaggggcccaggctcctctcctgcagcagcgcccc
caggagctgggagagttgagggtgctgggcagagatgagacagggcgcctccgtgtggtc
tggaccgcccagcctgacacctttgcctacttccaactgcgcatgcgggtgcccgagggg
ccgggggcacatgaggaagtgctgccaggggacgtccgccaggctctggtgcctccaccc
cctcctggaaccccgtatgagctgtcacttcatggggtccctcctgggggcaagccctct
gaccccatcatctaccaaggcattatggacaaggatgaggagaagcctgggaagtcctca
ggcccaccacgcctgggtgagctgacggtgacagacaggacctccgactccttgctcctg
cgctggacggtccccgagggcgagtttgactccttcgtgatccagtacaaagacagggac
gggcagccccaggtggtgcccgtggaaggaccccagcgctcggccgtcatcacctccctg
gatcctggccgcaagtacaaatttgtcctgtatgggtttgttggcaagaagaggcatggt
ccgctggtggctgaagccaagatcttgcctcagagtgacccaagtccagggactccaccc
cacctgggaaacctgtgggtgacagaccctaccccagattcactgcacctctcctggact
gtccctgagggccagtttgacaccttcatggtccagtacagggacagggatggacggccc
caggtggtacctgtggaagggcccgagcgttcatttgttgtctcctcactggaccctgac
cacaagtacagattcactctgtttggaattgcgaacaagaagcggtatggccccctcacg
gccgatggcaccactgctccagagaggaaagaggagcccccccgccctgagttcctggag
cagcccctcctgggggaactgacagtgaccggcgtgaccccagactccttgcgtctctca
tggacagtggcccagggccccttcgactcattcatggtccagtacaaggatgcacagggg
cagccccaggcagtgcctgttgcgggggatgagaatgaggttactgtccccggcctggat
cccgaccggaagtataagatgaacctctacgggcttcgtggcaggcagcgtgtggggccc
gagtctgtggtggccaagactgctcctcaggaggatgtggacgagacccccagccccaca
gaactgggcacggaggccccggagtcccccgaggagccgctcctgggggagctgacagtg
acaggatcctcccctgattcgctgagcctcttctggaccgtcccccagggcagcttcgac
tctttcaccgtgcagtacaaggacagggatgggcggccccgggcggtgcgtgttgggggc
aaggagagtgaggtcaccgtgggaggcctagagcccgggcacaagtacaagatgcacctg
tacggcctccacgaggggcagcgcgtgggcccggtgtccgccgtgggcgtgacagcccca
caacaagaagagacccctccagccactgagtccccgctggagccacgcctaggagagctg
acagtgacagatgtgacccccaactctgtgggcctctcctggacagtccccgagggccag
tttgactccttcatagtccagtacaaggacaaggacgggcagccccaggtggtgccggtg
gcggcagaccagcgagaggtcacagtctacaacctggagcctgagagaaaatataagatg
aacatgtatggactacatgatgggcaacgcatgggccccctgtctgtggtcatcgtgacg
gctcccctcccaccagccccagccacagaggcctccaagcctcccctggagccacgccta
ggggagctgacagtgacggatataacccctgactctgtgggcctctcatggacagtccct
gagggtgaattcgactcctttgtggttcagtacaaggacagggacgggcagccccaggtg
gtgcccgtggctgcagatcagcgggaggtcactatccctgacctggaaccctcccgcaag
tacaagttcctgctctttgggatccaggatgggaaacgacgcagcccagtctctgtggag
gcaaagacggttgcccgaggtgacgccagcccaggggccccaccccgccttggggagctg
tgggtgacagaccccaccccagactcactgcgcctctcctggacggttcctgagggccag
ttcgactcttttgtggtccagttcaaggacaaagacgggccccaggtggtgcccgtggag
ggccatgagcgctctgtcactgtcacccctctggatgccggccgcaagtacagattcctc
ctctatggcctcctgggcaagaagcgccatggccctctcactgccgacggcaccacggaa
gcccggagtgctatggatgatactggaacaaagcgtcccccaaaaccccgtctgggggag
gagctgcaggtgaccaccgtgacccagaactccgtgggcctctcctggacagtccctgag
ggccagtttgactcctttgtggtccagtacaaagacagggacgggcagccccaggtggtg
cccgtggagggcagcctcagggaggtcagcgtgccgggcctggaccctgcccacaggtac
aagctgctgctctacgggctgcaccacggcaagcgtgtgggccccatctcggccgtcgcc
attactgccggcagggaagaaacggaaactgagaccacggccccgacccctccagcgcct
gagccccacctcggggagttgacagtggaggaggccacgtcacacaccctgcatctctcc
tggatggtgactgagggagaatttgactccttcgaaatccagtacacagatagagacggg
caactccaaatggtccgcataggaggtgaccggaatgacatcaccctctctggcctggaa
tccgaccacagatacctggtgaccctgtatggtttcagtgatgggaagcatgtaggtcct
gtccatgtcgaggccctgacagtcccggaggaggagaagccttcagaacctcccaccgca
acccccgagccccccatcaagcctcgcctgggggagctgaccgtgacagatgccacccct
gactccctcagcctgtcctggacagttcccgagggacagtttgaccacttcctggtccag
tacaggaatggagatgggcagcccaaggcagtgagggtgccagggcacgaggaaggggtc
accatctcgggcctggagccagaccataaatacaagatgaacctgtacggcttccacggt
ggccagcgcatgggccctgtgtctgtcgtcggggtgacagctgcagaggaagagaccccc
agccccacagaacccagcatggaggccccggagcccgctgaggagccgctcctgggggag
ctaacagtgacaggatcctcccctgactcgctgagcctctcctggaccgtcccccagggc
cgcttcgactccttcaccgtgcagtacaaggacagggacgggcggccccaggtggtgcgt
gttgggggcgaggagagtgaagtcaccgtggggggcctggagcctgggcgcaagtacaag
atgcacctgtacggcctccacgaggggcggcgcgtgggcccagtgtctgctgtgggcgtc
acggcccccgaagaggagtcccctgatgctcctcttgcaaagctgcgcctagggcagatg
acagtgagagacatcacctccgactccctcagcctctcctggacagtccccgagggccag
tttgaccatttcttggtccagtttaagaatggggacgggcagcccaaggcggtgcgggtg
ccgggacacgaggatggggtcaccatctcgggcctggagccagaccacaagtacaagatg
aacctgtacggcttccacggtggccagcgcgtgggccccgtgtctgctgttggtttaact
gccccaggaaaggatgaagaaatggccccagcctcgacagaacctcccacccctgaaccc
cccatcaagcctcgcctggaggagctgaccgtgacagatgcgacccctgactccctcagc
ctgtcctggacggttcccgagggacagtttgaccacttcctggtccagtacaagaatggg
gatgggcagcccaaggcaacacgggtgccaggacatgaggacagggtcaccatctccggc
ctggagccagacaacaagtacaagatgaacctgtacggcttccacggtggccagcgtgtg
ggccccgtgtctgccatcggggtgacagctgcagaggaagagacccccagccccacagaa
cccagcatggaggccccggagccccctgaggagccgctcctgggggagctaacagtgaca
ggatcctcccctgactcgctgagcctctcctggaccgtcccccagggccgcttcgactcc
ttcaccgtgcagtacaaggacagggacgggcggccccaggtggtgcgtgttgggggcgag
gagagcgaggtcaccgtggggggcctggagcctgggcgcaaatacaagatgcacctgtat
ggcctccacgaggggcggcgcgtgggcccggtgtccaccgtgggcgtgactgccccacaa
gaggatgtggacgagacccccagccctacagaaccaggcacagaggccccagggcccccc
gaggagcctctcctgggggagctgacagtgacaggatcctcccctgactcgctgagcctt
tcctggaccgtcccccagggccgctttgactccttcaccgtgcagtacaaggacagggac
gggcggccccaggcggtgcgtgttgggggccaggagagcaaggtcactgtgaggggcctg
gagcctgggcgcaagtacaagatgcacctgtacggcctccacgaggggcggcgcctgggc
ccggtgtctgccgtgggcgtcacagaggatgaagccgagaccacccaagcagtgcctacc
atgacccctgagccccccatcaagcctcgcctgggggagctgaccatgacagatgccacc
cctgactccctcagcctgtcctggacggttcccgagggccagtttgaccacttcctggtc
cagtacaggaatggggatgggcagcccaaggcggtgcgggtgccggggcacgaggacggg
gtcaccatctcaggcctggagccagaccataaatacaagatgaacctgtacggcttccac
ggtggccagcgcgtgggccccatctctgtcattggggtgacggctgcagaggaagagacc
cccagccccacggaactcagcactgaggccccggagccccctgaggagccgctcctgggg
gagctgacagtgacaggatcctcccctgactcgctgagcctctcctggaccatcccccag
ggccacttcgactccttcaccgtgcagtacaaggacagggacgggcggccccaggtgatg
cgtgtcaggggcgaggagagcgaggtcaccgtggggggcctggagcccgggcgcaaatac
aagatgcacctgtacggcctccacgaggggcggcgtgtgggcccggtgtccaccgtgggt
gtgacagaggatgaagcagagaccacccaagcagtgcccaccacaacccctgagcccccc
aacaagcctcgcctcggggagctgaccgtgacagatgccacccctgactccctcagcctg
tcctggatggtccccgagggccagtttgaccacttcctggtccagtacaggaatggggat
gggcagcccaaggtggtgcgggtgccggggcacgaggacggggtcaccatctcaggcctg
gagccagaccacaagtacaagatgaacctgtacggcttccacggtggccagcgcgtgggc
cccatctctgtcattggggtgacagctgcagaggaagaaactcccgcccccacagaaccc
agcacggaggccccggagccccctgaggagccgctcctgggggagctgacagtgacagga
tcctcccctgactcgctgagcctctcctggaccatcccccagggccgcttcgactccttc
actgtgcagtacaaggacagggacgggcggccccaggtggtgcgtgtcaggggcgaggag
agcgaggtcaccgtggggggcctggagcccgggtgcaaatacaagatgcacctgtacggc
ctccacgaggggcagcgcgtgggcccagtgtccgctgtgggtgtgacagctccaaaggat
gaagccgagaccacccaagcagtgcctaccatgacccctgagccccccatcaagcctcgc
ctgggggagctgaccgtgacagatgccacccccgactccctcagcctgtcctggatggtt
cccgagggccagtttgaccacttcctggtccagtacaggaatggggatgggcagcccaag
gcggtgcgggtgccggggcacgaggacggggtcaccatctcaggcctggagccagaccat
aaatacaagatgaacctgtacggcttccacggtggccagcgcgtaggccctgtgtctgcc
attggggtgacggaggaagagacccccagccccacagaacccagcactgaggccccggag
gcccctgaggagccgctcctgggggagttgacagtgacaggatcctcccctgactcgctg
agcctctcctggaccgtcccccagggccgcttcgactccttcaccgtgcagtacaaggac
agggacgggcagccccaggtggtgcgtgtcaggggcgaggagagcgaggtcaccgtgggg
ggcctggagcccgggcgcaaatacaagatgcatctgtacggcctccacgaggggcagcgc
gtgggcccagtgtccaccgtgggcatcacggcgcccctgcccacaccactgccggtggag
ccccgcctgggggagctggcggtggcggccgtgacctcggactcagtgggcctctcatgg
acggtggcccagggcccctttgactccttcctggtacagtacagggacgcgcaggggcag
ccccaggcagtgcctgtgagcggagacctccgagcggtcgccgtctcggggctggacccg
gcccgcaagtacaagttcctgctctttggactccagaatgggaaacgccacggcccagtc
cctgtggaggccaggaccgccccagacaccaaaccgtctccccgcctgggggagctgact
gtgacagatgcgacccctgactccgtgggcctctcgtggacggtccctgagggcgaattc
gactccttcgtggtccagtacaaggataaggatggtcggctccaggtggtgccggtggca
gccaaccagcgggaggtcacagtccagggcctggagcccagtaggaaatacaggttcctg
ctctatggtctgtcaggcaggaaacgactgggccccatctctgctgacagcaccacagct
cccctggagaaggagctacctccccacctgggggaactgaccgtggctgaggagacctcc
agctctctgcgcctgtcctggacggtagcccagggcccctttgactccttcgtggtccag
tacagggacacggacgggcagcccagggcagtgcctgtggccgcagaccagcgcacagtc
accgtagaggacctggagcctggcaagaaatacaagtttctgctctacgggctccttggg
ggaaagcgcctgggcccggtctctgccctgggaatgacagccccagaagaggacacacca
gccccagagttagccccagaggcccctgagcctcctgaagagccccgcctaggagtgctg
accgtgaccgacacaaccccagactccatgcgcctctcgtggagcgtggcccagggcccc
tttgattccttcgtggtccagtatgaggacacgaacgggcagccccaggccttgctcgtg
gacggcgaccagagcaagatcctcatctcaggcctggagcccagcaccccctacaggttc
ctcctctatggcctccatgaagggaagcgcctggggcccctctcagctgagggcaccaca
gggctggctcctgctggtcagacctcagaggagtcaaggccccgcctgtcccagctgtct
gtgactgacgtgaccaccagttcactgaggctcaactgggaggccccaccgggggccttc
gactccttcctgctccgctttggggttccatcaccaagcactctggagccgcatccgcgt
ccactgctgcagcgcgagctgatggtgccggggacgcggcactcggccgtgctccgggac
ctgcgttccgggactctgtacagcctgacactgtatgggctgcgaggaccccacaaggcc
gacagcatccagggaaccgcccgcaccctcagcccagttctggagagcccccgtgacctc
caattcagtgaaatcagggagacctcagccaaggtcaactggatgcccccaccatcccgg
gcggacagcttcaaagtctcctaccagctggcggacggaggggagcctcagagtgtgcag
gtggatggccaggcccggacccagaaactccaggggctgatcccaggcgctcgctatgag
gtgaccgtggtctcggtccgaggctttgaggagagtgagcctctcacaggcttcctcacc
acggttcctgacggtcccacacagttgcgtgcactgaacttgaccgagggattcgccgtg
ctgcactggaagcccccccagaatcctgtggacacctatgacgtccaggtcacagcccct
ggggccccgcctctgcaggcggagaccccaggcagcgcggtggactaccccctgcatgac
cttgtcctccacaccaactacaccgccacagtgcgtggcctgcggggccccaacctcact
tccccagccagcatcaccttcaccacagggctagaggcccctcgggacttggaggccaag
gaagtgaccccccgcaccgccctgctcacttggactgagcccccagtccggcccgcaggc
tacctgctcagcttccacacccctggtggacagaaccaggagatcctgctcccaggaggg
atcacatctcaccagctccttggcctctttccctccacctcctacaatgcacggctccag
gccatgtggggccagagcctcctgccgcccgtgtccacctctttcaccacgggtgggctg
cggatccccttccccagggactgcggggaggagatgcagaacggagccggtgcctccagg
accagcaccatcttcctcaacggcaaccgcgagcggcccctgaacgtgttttgcgacatg
gagactgatgggggcggctggctggtgttccagcgccgcatggatggacagacagacttc
tggagggactgggaggactatgcccatggttttgggaacatctctggagagttctggctg
ggcaatgaggccctgcacagcctgacacaggcaggtgactactccatgcgcgtggacctg
cgggctggggacgaggctgtgttcgcccagtacgactccttccacgtagactcggctgcg
gagtactaccgcctccacttggagggctaccacggcaccgcaggggactccatgagctac
cacagcggcagtgtcttctctgcccgtgatcgggaccccaacagcttgctcatctcctgc
gctgtctcctaccgaggggcctggtggtacaggaactgccactacgccaacctcaacggg
ctctacgggagcacagtggaccatcagggagtgagctggtaccactggaagggcttcgag
ttctcggtgcccttcacggaaatgaagctgagaccaagaaactttcgctccccagcgggg
ggaggctga

DBGET integrated database retrieval system