KEGG   Homo sapiens (human): 7173Help
Entry
7173              CDS       T01001                                 

Gene name
TPO, MSA, TDH2A, TPX
Definition
(RefSeq) thyroid peroxidase
  KO
K00431  thyroid peroxidase [EC:1.11.1.8]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00350  Tyrosine metabolism
hsa01100  Metabolic pathways
hsa04918  Thyroid hormone synthesis
hsa05320  Autoimmune thyroid disease
Module
hsa_M00043  Thyroid hormone biosynthesis, tyrosine => triiodothyronine/thyroxine
Disease
H00251  Thyroid dyshormonogenesis
Drug target
Benzylthiouracil: D07519
Carbimazole: D07616
Methylthiouracil: D07231
Propylthiouracil: D00562
Thiamazole: D00401
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    7173 (TPO)
 Organismal Systems
  Endocrine system
   04918 Thyroid hormone synthesis
    7173 (TPO)
 Human Diseases
  Immune diseases
   05320 Autoimmune thyroid disease
    7173 (TPO)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.8  iodide peroxidase
     7173 (TPO)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF_CA Sushi cEGF EGF_3 FXa_inhibition EGF LRRNT
Motif
Other DBs
NCBI-GeneID: 7173
NCBI-ProteinID: NP_000538
OMIM: 606765
HGNC: 12015
Ensembl: ENSG00000115705
Vega: OTTHUMG00000090271
Pharos: P07202(Tclin)
UniProt: P07202 Q502Y3 Q6P534
Position
2p25.3
AA seq 933 aa AA seqDB search
MRALAVLSVTLVMACTEAFFPFISRGKELLWGKPEESRVSSVLEESKRLVDTAMYATMQR
NLKKRGILSPAQLLSFSKLPEPTSGVIARAAEIMETSIQAMKRKVNLKTQQSQHPTDALS
EDLLSIIANMSGCLPYMLPPKCPNTCLANKYRPITGACNNRDHPRWGASNTALARWLPPV
YEDGFSQPRGWNPGFLYNGFPLPPVREVTRHVIQVSNEVVTDDDRYSDLLMAWGQYIDHD
IAFTPQSTSKAAFGGGADCQMTCENQNPCFPIQLPEEARPAAGTACLPFYRSSAACGTGD
QGALFGNLSTANPRQQMNGLTSFLDASTVYGSSPALERQLRNWTSAEGLLRVHARLRDSG
RAYLPFVPPRAPAACAPEPGIPGETRGPCFLAGDGRASEVPSLTALHTLWLREHNRLAAA
LKALNAHWSADAVYQEARKVVGALHQIITLRDYIPRILGPEAFQQYVGPYEGYDSTANPT
VSNVFSTAAFRFGHATIHPLVRRLDASFQEHPDLPGLWLHQAFFSPWTLLRGGGLDPLIR
GLLARPAKLQVQDQLMNEELTERLFVLSNSSTLDLASINLQRGRDHGLPGYNEWREFCGL
PRLETPADLSTAIASRSVADKILDLYKHPDNIDVWLGGLAENFLPRARTGPLFACLIGKQ
MKALRDGDWFWWENSHVFTDAQRRELEKHSLSRVICDNTGLTRVPMDAFQVGKFPEDFES
CDSITGMNLEAWRETFPQDDKCGFPESVENGDFVHCEESGRRVLVYSCRHGYELQGREQL
TCTQEGWDFQPPLCKDVNECADGAHPPCHASARCRNTKGGFQCLCADPYELGDDGRTCVD
SGRLPRVTWISMSLAALLIGGFAGLTSTVICRWTRTGTKSTLPISETGGGTPELRCGKHQ
AVGTSPQRAAAQDSEQESAGMEGRDTHRLPRAL
NT seq 2802 nt NT seq  +upstreamnt  +downstreamnt
atgagagcgctcgctgtgctgtctgtcacgctggttatggcctgcacagaagccttcttc
cccttcatctcgagagggaaagaactcctttggggaaagcctgaggagtctcgtgtctct
agcgtcttggaggaaagcaagcgcctggtggacaccgccatgtacgccacgatgcagaga
aacctcaagaaaagaggaatcctttctccagctcagcttctgtctttttccaaacttcct
gagccaacaagcggagtgattgcccgagcagcagagataatggaaacatcaatacaagcg
atgaaaagaaaagtcaacctgaaaactcaacaatcacagcatccaacggatgctttatca
gaagatctgctgagcatcattgcaaacatgtctggatgtctcccttacatgctgccccca
aaatgcccaaacacttgcctggcgaacaaatacaggcccatcacaggagcttgcaacaac
agagaccaccccagatggggcgcctccaacacggccctggcacgatggctccctccagtc
tatgaggacggcttcagtcagccccgaggctggaaccccggcttcttgtacaacgggttc
ccactgcccccggtccgggaggtgacaagacatgtcattcaagtttcaaatgaggttgtc
acagatgatgaccgctattctgacctcctgatggcatggggacaatacatcgaccacgac
atcgcgttcacaccacagagcaccagcaaagctgccttcgggggaggggctgactgccag
atgacttgtgagaaccaaaacccatgttttcccatacaactcccggaggaggcccggccg
gccgcgggcaccgcctgtctgcccttctaccgctcttcggccgcctgcggcaccggggac
caaggcgcgctctttgggaacctgtccacggccaacccgcggcagcagatgaacgggttg
acctcgttcctggacgcgtccaccgtgtatggcagctccccggccctagagaggcagctg
cggaactggaccagtgccgaagggctgctccgcgtccacgcgcgcctccgggactccggc
cgcgcctacctgcccttcgtgccgccacgcgcgcctgcggcctgtgcgcccgagcccggc
atccccggagagacccgcgggccctgcttcctggccggagacggccgcgccagcgaggtc
ccctccctgacggcactgcacacgctgtggctgcgcgagcacaaccgcctggccgcggcg
ctcaaggccctcaatgcgcactggagcgcggacgccgtgtaccaggaggcgcgcaaggtc
gtgggcgctctgcaccagatcatcaccctgagggattacatccccaggatcctgggaccc
gaggccttccagcagtacgtgggtccctatgaaggctatgactccaccgccaaccccact
gtgtccaacgtgttctccacagccgccttccgcttcggccatgccacgatccacccgctg
gtgaggaggctggacgccagcttccaggagcaccccgacctgcccgggctgtggctgcac
caggctttcttcagcccatggacattactccgtggaggtggtttggacccactaatacga
ggccttcttgcaagaccagccaaactgcaggtgcaggatcagctgatgaacgaggagctg
acggaaaggctctttgtgctgtccaattccagcaccttggatctggcgtccatcaacctg
cagaggggccgggaccacgggctgccaggttacaatgagtggagggagttctgcggcctg
cctcgcctggagacccccgctgacctgagcacagccatcgccagcaggagcgtggccgac
aagatcctggacttgtacaagcatcctgacaacatcgatgtctggctgggaggcttagct
gaaaacttcctccccagggctcggacagggcccctgtttgcctgtctcattgggaagcag
atgaaggctctgcgggacggtgactggttttggtgggagaacagccacgtcttcacggat
gcacagaggcgtgagctggagaagcactccctgtctcgggtcatctgtgacaacactggc
ctcaccagggtgcccatggatgccttccaagtcggcaaattccccgaagactttgagtct
tgtgacagcatcactggcatgaacctggaggcctggagggaaacctttcctcaagacgac
aagtgtggcttcccagagagcgtggagaatggggactttgtgcactgtgaggagtctggg
aggcgcgtgctggtgtattcctgccggcacgggtatgagctccaaggccgggagcagctc
acttgcacccaggaaggatgggatttccagcctcccctctgcaaagatgtgaacgagtgt
gcagacggtgcccaccccccctgccacgcctctgcgaggtgcagaaacaccaaaggcggc
ttccagtgtctctgcgcggacccctacgagttaggagacgatgggagaacctgcgtagac
tccgggaggctccctcgggtgacttggatctccatgtcgctggctgctctgctgatcgga
ggcttcgcaggtctcacctcgacggtgatttgcaggtggacacgcactggcactaaatcc
acactgcccatctcggagacaggcggaggaactcccgagctgagatgcggaaagcaccag
gccgtagggacctcaccgcagcgggccgcagctcaggactcggagcaggagagtgctggg
atggaaggccgggatactcacaggctgccgagagccctctga

DBGET integrated database retrieval system