KEGG   Homo sapiens (human): 718Help
Entry
718               CDS       T01001                                 

Gene name
C3, AHUS5, ARMD9, ASP, C3a, C3b, CPAMD1, HEL-S-62p
Definition
(RefSeq) complement C3
  KO
K03990  complement component 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04610  Complement and coagulation cascades
hsa05133  Pertussis
hsa05134  Legionellosis
hsa05140  Leishmaniasis
hsa05142  Chagas disease (American trypanosomiasis)
hsa05150  Staphylococcus aureus infection
hsa05152  Tuberculosis
hsa05167  Kaposi's sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex infection
hsa05203  Viral carcinogenesis
hsa05322  Systemic lupus erythematosus
Network
N00213  KSHV KCP to host-cell-protein inhibition
Disease
H00102  Classic complement pathway component defects
H00821  Age-related macular degeneration
H01434  Atypical hemolytic uremic syndrome (aHUS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    718 (C3)
 Organismal Systems
  Immune system
   04610 Complement and coagulation cascades
    718 (C3)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    718 (C3)
  Immune diseases
   05322 Systemic lupus erythematosus
    718 (C3)
  Infectious diseases
   05133 Pertussis
    718 (C3)
   05134 Legionellosis
    718 (C3)
   05150 Staphylococcus aureus infection
    718 (C3)
   05152 Tuberculosis
    718 (C3)
   05168 Herpes simplex infection
    718 (C3)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    718 (C3)
   05140 Leishmaniasis
    718 (C3)
   05142 Chagas disease (American trypanosomiasis)
    718 (C3)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Opsonins
    718 (C3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   718 (C3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: A2M_comp A2M_recep A2M NTR A2M_N_2 A2M_N Thiol-ester_cl ANATO
Motif
Other DBs
NCBI-GeneID: 718
NCBI-ProteinID: NP_000055
OMIM: 120700
HGNC: 1318
Ensembl: ENSG00000125730
Vega: OTTHUMG00000150335
Pharos: P01024(Tbio)
UniProt: P01024 V9HWA9 B4DR57
Structure
PDB: 

Position
19p13.3
AA seq 1663 aa AA seqDB search
MGPTSGPSLLLLLLTHLPLALGSPMYSIITPNILRLESEETMVLEAHDAQGDVPVTVTVH
DFPGKKLVLSSEKTVLTPATNHMGNVTFTIPANREFKSEKGRNKFVTVQATFGTQVVEKV
VLVSLQSGYLFIQTDKTIYTPGSTVLYRIFTVNHKLLPVGRTVMVNIENPEGIPVKQDSL
SSQNQLGVLPLSWDIPELVNMGQWKIRAYYENSPQQVFSTEFEVKEYVLPSFEVIVEPTE
KFYYIYNEKGLEVTITARFLYGKKVEGTAFVIFGIQDGEQRISLPESLKRIPIEDGSGEV
VLSRKVLLDGVQNPRAEDLVGKSLYVSATVILHSGSDMVQAERSGIPIVTSPYQIHFTKT
PKYFKPGMPFDLMVFVTNPDGSPAYRVPVAVQGEDTVQSLTQGDGVAKLSINTHPSQKPL
SITVRTKKQELSEAEQATRTMQALPYSTVGNSNNYLHLSVLRTELRPGETLNVNFLLRMD
RAHEAKIRYYTYLIMNKGRLLKAGRQVREPGQDLVVLPLSITTDFIPSFRLVAYYTLIGA
SGQREVVADSVWVDVKDSCVGSLVVKSGQSEDRQPVPGQQMTLKIEGDHGARVVLVAVDK
GVFVLNKKNKLTQSKIWDVVEKADIGCTPGSGKDYAGVFSDAGLTFTSSSGQQTAQRAEL
QCPQPAARRRRSVQLTEKRMDKVGKYPKELRKCCEDGMRENPMRFSCQRRTRFISLGEAC
KKVFLDCCNYITELRRQHARASHLGLARSNLDEDIIAEENIVSRSEFPESWLWNVEDLKE
PPKNGISTKLMNIFLKDSITTWEILAVSMSDKKGICVADPFEVTVMQDFFIDLRLPYSVV
RNEQVEIRAVLYNYRQNQELKVRVELLHNPAFCSLATTKRRHQQTVTIPPKSSLSVPYVI
VPLKTGLQEVEVKAAVYHHFISDGVRKSLKVVPEGIRMNKTVAVRTLDPERLGREGVQKE
DIPPADLSDQVPDTESETRILLQGTPVAQMTEDAVDAERLKHLIVTPSGCGEQNMIGMTP
TVIAVHYLDETEQWEKFGLEKRQGALELIKKGYTQQLAFRQPSSAFAAFVKRAPSTWLTA
YVVKVFSLAVNLIAIDSQVLCGAVKWLILEKQKPDGVFQEDAPVIHQEMIGGLRNNNEKD
MALTAFVLISLQEAKDICEEQVNSLPGSITKAGDFLEANYMNLQRSYTVAIAGYALAQMG
RLKGPLLNKFLTTAKDKNRWEDPGKQLYNVEATSYALLALLQLKDFDFVPPVVRWLNEQR
YYGGGYGSTQATFMVFQALAQYQKDAPDHQELNLDVSLQLPSRSSKITHRIHWESASLLR
SEETKENEGFTVTAEGKGQGTLSVVTMYHAKAKDQLTCNKFDLKVTIKPAPETEKRPQDA
KNTMILEICTRYRGDQDATMSILDISMMTGFAPDTDDLKQLANGVDRYISKYELDKAFSD
RNTLIIYLDKVSHSEDDCLAFKVHQYFNVELIQPGAVKVYAYYNLEESCTRFYHPEKEDG
KLNKLCRDELCRCAEENCFIQKSDDKVTLEERLDKACEPGVDYVYKTRLVKVQLSNDFDE
YIMAIEQTIKSGSDEVQVGQQRTFISPIKCREALKLEEKKHYLMWGLSSDFWGEKPNLSY
IIGKDTWVEHWPEEDECQDEENQKQCQDLGAFTESMVVFGCPN
NT seq 4992 nt NT seq  +upstreamnt  +downstreamnt
atgggacccacctcaggtcccagcctgctgctcctgctactaacccacctccccctggct
ctggggagtcccatgtactctatcatcacccccaacatcttgcggctggagagcgaggag
accatggtgctggaggcccacgacgcgcaaggggatgttccagtcactgttactgtccac
gacttcccaggcaaaaaactagtgctgtccagtgagaagactgtgctgacccctgccacc
aaccacatgggcaacgtcaccttcacgatcccagccaacagggagttcaagtcagaaaag
gggcgcaacaagttcgtgaccgtgcaggccaccttcgggacccaagtggtggagaaggtg
gtgctggtcagcctgcagagcgggtacctcttcatccagacagacaagaccatctacacc
cctggctccacagttctctatcggatcttcaccgtcaaccacaagctgctacccgtgggc
cggacggtcatggtcaacattgagaacccggaaggcatcccggtcaagcaggactccttg
tcttctcagaaccagcttggcgtcttgcccttgtcttgggacattccggaactcgtcaac
atgggccagtggaagatccgagcctactatgaaaactcaccacagcaggtcttctccact
gagtttgaggtgaaggagtacgtgctgcccagtttcgaggtcatagtggagcctacagag
aaattctactacatctataacgagaagggcctggaggtcaccatcaccgccaggttcctc
tacgggaagaaagtggagggaactgcctttgtcatcttcgggatccaggatggcgaacag
aggatttccctgcctgaatccctcaagcgcattccgattgaggatggctcgggggaggtt
gtgctgagccggaaggtactgctggacggggtgcagaacccccgagcagaagacctggtg
gggaagtctttgtacgtgtctgccaccgtcatcttgcactcaggcagtgacatggtgcag
gcagagcgcagcgggatccccatcgtgacctctccctaccagatccacttcaccaagaca
cccaagtacttcaaaccaggaatgccctttgacctcatggtgttcgtgacgaaccctgat
ggctctccagcctaccgagtccccgtggcagtccagggcgaggacactgtgcagtctcta
acccagggagatggcgtggccaaactcagcatcaacacacaccccagccagaagcccttg
agcatcacggtgcgcacgaagaagcaggagctctcggaggcagagcaggctaccaggacc
atgcaggctctgccctacagcaccgtgggcaactccaacaattacctgcatctctcagtg
ctacgtacagagctcagacccggggagaccctcaacgtcaacttcctcctgcgaatggac
cgcgcccacgaggccaagatccgctactacacctacctgatcatgaacaagggcaggctg
ttgaaggcgggacgccaggtgcgagagcccggccaggacctggtggtgctgcccctgtcc
atcaccaccgacttcatcccttccttccgcctggtggcgtactacacgctgatcggtgcc
agcggccagagggaggtggtggccgactccgtgtgggtggacgtcaaggactcctgcgtg
ggctcgctggtggtaaaaagcggccagtcagaagaccggcagcctgtacctgggcagcag
atgaccctgaagatagagggtgaccacggggcccgggtggtactggtggccgtggacaag
ggcgtgttcgtgctgaataagaagaacaaactgacgcagagtaagatctgggacgtggtg
gagaaggcagacatcggctgcaccccgggcagtgggaaggattacgccggtgtcttctcc
gacgcagggctgaccttcacgagcagcagtggccagcagaccgcccagagggcagaactt
cagtgcccgcagccagccgcccgccgacgccgttccgtgcagctcacggagaagcgaatg
gacaaagtcggcaagtaccccaaggagctgcgcaagtgctgcgaggacggcatgcgggag
aaccccatgaggttctcgtgccagcgccggacccgtttcatctccctgggcgaggcgtgc
aagaaggtcttcctggactgctgcaactacatcacagagctgcggcggcagcacgcgcgg
gccagccacctgggcctggccaggagtaacctggatgaggacatcattgcagaagagaac
atcgtttcccgaagtgagttcccagagagctggctgtggaacgttgaggacttgaaagag
ccaccgaaaaatggaatctctacgaagctcatgaatatatttttgaaagactccatcacc
acgtgggagattctggctgtgagcatgtcggacaagaaagggatctgtgtggcagacccc
ttcgaggtcacagtaatgcaggacttcttcatcgacctgcggctaccctactctgttgtt
cgaaacgagcaggtggaaatccgagccgttctctacaattaccggcagaaccaagagctc
aaggtgagggtggaactactccacaatccagccttctgcagcctggccaccaccaagagg
cgtcaccagcagaccgtaaccatcccccccaagtcctcgttgtccgttccatatgtcatc
gtgccgctaaagaccggcctgcaggaagtggaagtcaaggctgctgtctaccatcatttc
atcagtgacggtgtcaggaagtccctgaaggtcgtgccggaaggaatcagaatgaacaaa
actgtggctgttcgcaccctggatccagaacgcctgggccgtgaaggagtgcagaaagag
gacatcccacctgcagacctcagtgaccaagtcccggacaccgagtctgagaccagaatt
ctcctgcaagggaccccagtggcccagatgacagaggatgccgtcgacgcggaacggctg
aagcacctcattgtgaccccctcgggctgcggggaacagaacatgatcggcatgacgccc
acggtcatcgctgtgcattacctggatgaaacggagcagtgggagaagttcggcctagag
aagcggcagggggccttggagctcatcaagaaggggtacacccagcagctggccttcaga
caacccagctctgcctttgcggccttcgtgaaacgggcacccagcacctggctgaccgcc
tacgtggtcaaggtcttctctctggctgtcaacctcatcgccatcgactcccaagtcctc
tgcggggctgttaaatggctgatcctggagaagcagaagcccgacggggtcttccaggag
gatgcgcccgtgatacaccaagaaatgattggtggattacggaacaacaacgagaaagac
atggccctcacggcctttgttctcatctcgctgcaggaggctaaagatatttgcgaggag
caggtcaacagcctgccaggcagcatcactaaagcaggagacttccttgaagccaactac
atgaacctacagagatcctacactgtggccattgctggctatgctctggcccagatgggc
aggctgaaggggcctcttcttaacaaatttctgaccacagccaaagataagaaccgctgg
gaggaccctggtaagcagctctacaacgtggaggccacatcctatgccctcttggcccta
ctgcagctaaaagactttgactttgtgcctcccgtcgtgcgttggctcaatgaacagaga
tactacggtggtggctatggctctacccaggccaccttcatggtgttccaagccttggct
caataccaaaaggacgcccctgaccaccaggaactgaaccttgatgtgtccctccaactg
cccagccgcagctccaagatcacccaccgtatccactgggaatctgccagcctcctgcga
tcagaagagaccaaggaaaatgagggtttcacagtcacagctgaaggaaaaggccaaggc
accttgtcggtggtgacaatgtaccatgctaaggccaaagatcaactcacctgtaataaa
ttcgacctcaaggtcaccataaaaccagcaccggaaacagaaaagaggcctcaggatgcc
aagaacactatgatccttgagatctgtaccaggtaccggggagaccaggatgccactatg
tctatattggacatatccatgatgactggctttgctccagacacagatgacctgaagcag
ctggccaatggtgttgacagatacatctccaagtatgagctggacaaagccttctccgat
aggaacaccctcatcatctacctggacaaggtctcacactctgaggatgactgtctagct
ttcaaagttcaccaatactttaatgtagagcttatccagcctggagcagtcaaggtctac
gcctattacaacctggaggaaagctgtacccggttctaccatccggaaaaggaggatgga
aagctgaacaagctctgccgtgatgaactgtgccgctgtgctgaggagaattgcttcata
caaaagtcggatgacaaggtcaccctggaagaacggctggacaaggcctgtgagccagga
gtggactatgtgtacaagacccgactggtcaaggttcagctgtccaatgactttgacgag
tacatcatggccattgagcagaccatcaagtcaggctcggatgaggtgcaggttggacag
cagcgcacgttcatcagccccatcaagtgcagagaagccctgaagctggaggagaagaaa
cactacctcatgtggggtctctcctccgatttctggggagagaagcccaacctcagctac
atcatcgggaaggacacttgggtggagcactggcccgaggaggacgaatgccaagacgaa
gagaaccagaaacaatgccaggacctcggcgccttcaccgagagcatggttgtctttggg
tgccccaactga

DBGET integrated database retrieval system