KEGG   Homo sapiens (human): 721Help
Entry
721               CDS       T01001                                 

Gene name
C4B, C4B1, C4B12, C4B2, C4B3, C4B5, C4BD, C4B_2, C4F, CH, CO4, CPAMD3
Definition
(RefSeq) complement C4B (Chido blood group)
  KO
K03989  complement component 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
hsa05133  Pertussis
hsa05150  Staphylococcus aureus infection
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    721 (C4B)
 09160 Human Diseases
  09163 Immune diseases
   05322 Systemic lupus erythematosus
    721 (C4B)
  09171 Infectious diseases: Bacterial
   05133 Pertussis
    721 (C4B)
   05150 Staphylococcus aureus infection
    721 (C4B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    721 (C4B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   721 (C4B)
  Exosomal proteins of other cancer cells
   721 (C4B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TED_complement A2M_recep A2M A2M_BRD NTR MG3 MG2 ANATO MG4 Big_1 Prenyltrans
Motif
Other DBs
NCBI-GeneID: 721
NCBI-ProteinID: NP_001002029
OMIM: 120820
HGNC: 1324
Ensembl: ENSG00000224389
Vega: OTTHUMG00000031187
Pharos: P0C0L5(Tbio) P0C0L4(Tbio)
UniProt: P0C0L4 P0C0L5
Structure
PDB: 

Position
6p21.33
AA seq 1744 aa AA seqDB search
MRLLWGLIWASSFFTLSLQKPRLLLFSPSVVHLGVPLSVGVQLQDVPRGQVVKGSVFLRN
PSRNNVPCSPKVDFTLSSERDFALLSLQVPLKDAKSCGLHQLLRGPEVQLVAHSPWLKDS
LSRTTNIQGINLLFSSRRGHLFLQTDQPIYNPGQRVRYRVFALDQKMRPSTDTITVMVEN
SHGLRVRKKEVYMPSSIFQDDFVIPDISEPGTWKISARFSDGLESNSSTQFEVKKYVLPN
FEVKITPGKPYILTVPGHLDEMQLDIQARYIYGKPVQGVAYVRFGLLDEDGKKTFFRGLE
SQTKLVNGQSHISLSKAEFQDALEKLNMGITDLQGLRLYVAAAIIESPGGEMEEAELTSW
YFVSSPFSLDLSKTKRHLVPGAPFLLQALVREMSGSPASGIPVKVSATVSSPGSVPEVQD
IQQNTDGSGQVSIPIIIPQTISELQLSVSAGSPHPAIARLTVAAPPSGGPGFLSIERPDS
RPPRVGDTLNLNLRAVGSGATFSHYYYMILSRGQIVFMNREPKRTLTSVSVFVDHHLAPS
FYFVAFYYHGDHPVANSLRVDVQAGACEGKLELSVDGAKQYRNGESVKLHLETDSLALVA
LGALDTALYAAGSKSHKPLNMGKVFEAMNSYDLGCGPGGGDSALQVFQAAGLAFSDGDQW
TLSRKRLSCPKEKTTRKKRNVNFQKAINEKLGQYASPTAKRCCQDGVTRLPMMRSCEQRA
ARVQQPDCREPFLSCCQFAESLRKKSRDKGQAGLQRALEILQEEDLIDEDDIPVRSFFPE
NWLWRVETVDRFQILTLWLPDSLTTWEIHGLSLSKTKGLCVATPVQLRVFREFHLHLRLP
MSVRRFEQLELRPVLYNYLDKNLTVSVHVSPVEGLCLAGGGGLAQQVLVPAGSARPVAFS
VVPTAATAVSLKVVARGSFEFPVGDAVSKVLQIEKEGAIHREELVYELNPLDHRGRTLEI
PGNSDPNMIPDGDFNSYVRVTASDPLDTLGSEGALSPGGVASLLRLPRGCGEQTMIYLAP
TLAASRYLDKTEQWSTLPPETKDHAVDLIQKGYMRIQQFRKADGSYAAWLSRGSSTWLTA
FVLKVLSLAQEQVGGSPEKLQETSNWLLSQQQADGSFQDLSPVIHRSMQGGLVGNDETVA
LTAFVTIALHHGLAVFQDEGAEPLKQRVEASISKASSFLGEKASAGLLGAHAAAITAYAL
TLTKAPADLRGVAHNNLMAMAQETGDNLYWGSVTGSQSNAVSPTPAPRNPSDPMPQAPAL
WIETTAYALLHLLLHEGKAEMADQAAAWLTRQGSFQGGFRSTQDTVIALDALSAYWIASH
TTEERGLNVTLSSTGRNGFKSHALQLNNRQIRGLEEELQFSLGSKINVKVGGNSKGTLKV
LRTYNVLDMKNTTCQDLQIEVTVKGHVEYTMEANEDYEDYEYDELPAKDDPDAPLQPVTP
LQLFEGRRNRRRREAPKVVEEQESRVHYTVCIWRNGKVGLSGMAIADVTLLSGFHALRAD
LEKLTSLSDRYVSHFETEGPHVLLYFDSVPTSRECVGFEAVQEVPVGLVQPASATLYDYY
NPERRCSVFYGAPSKSRLLATLCSAEVCQCAEGKCPRQRRALERGLQDEDGYRMKFACYY
PRVEYGFQVKVLREDSRAAFRLFETKITQVLHFTKDVKAAANQMRNFLVRASCRLRLEPG
KEYLIMGLDGATYDLEGHPQYLLDSNSWIEEMPSERLCRSTRQRAACAQLNDFLQEYGTQ
GCQV
NT seq 5235 nt NT seq  +upstreamnt  +downstreamnt
atgaggctgctctgggggctgatctgggcatccagcttcttcaccttatctctgcagaag
cccaggttgctcttgttctctccttctgtggttcatctgggggtccccctatcggtgggg
gtgcagctccaggatgtgccccgaggacaggtagtgaaaggatcagtgttcctgagaaac
ccatctcgtaataatgtcccctgctccccaaaggtggacttcacccttagctcagaaaga
gacttcgcactcctcagtctccaggtgcccttgaaagatgcgaagagctgtggcctccat
caactcctcagaggccctgaggtccagctggtggcccattcgccatggctaaaggactct
ctgtccagaacgacaaacatccagggtatcaacctgctcttctcctctcgccgggggcac
ctctttttgcagacggaccagcccatttacaaccctggccagcgggttcggtaccgggtc
tttgctctggatcagaagatgcgcccgagcactgacaccatcacagtcatggtggagaac
tctcacggcctccgcgtgcggaagaaggaggtgtacatgccctcgtccatcttccaggat
gactttgtgatcccagacatctcagagccagggacctggaagatctcagcccgattctca
gatggcctggaatccaacagcagcacccagtttgaggtgaagaaatatgtccttcccaac
tttgaggtgaagatcacccctggaaagccctacatcctgacggtgccaggccatcttgat
gaaatgcagttagacatccaggccaggtacatctatgggaagccagtgcagggggtggca
tatgtgcgctttgggctcctagatgaggatggtaagaagactttctttcgggggctggag
agtcagaccaagctggtgaatggacagagccacatttccctctcaaaggcagagttccag
gacgccctggagaagctgaatatgggcattactgacctccaggggctgcgcctctacgtt
gctgcagccatcattgagtctccaggtggggagatggaggaggcagagctcacatcctgg
tattttgtgtcatctcccttctccttggatcttagcaagaccaagcgacaccttgtgcct
ggggcccccttcctgctgcaggccttggtccgtgagatgtcaggctccccagcttctggc
attcctgtcaaagtttctgccacggtgtcttctcctgggtctgttcctgaagtccaggac
attcagcaaaacacagacgggagcggccaagtcagcattccaataattatccctcagacc
atctcagagctgcagctctcagtatctgcaggctccccacatccagcgatagccaggctc
actgtggcagccccaccttcaggaggccccgggtttctgtctattgagcggccggattct
cgacctcctcgtgttggggacactctgaacctgaacttgcgagccgtgggcagtggggcc
accttttctcattactactacatgatcctatcccgagggcagatcgtgttcatgaatcga
gagcccaagaggaccctgacctcggtctcggtgtttgtggaccatcacctggcaccctcc
ttctactttgtggccttctactaccatggagaccacccagtggccaactccctgcgagtg
gatgtccaggctggggcctgcgagggcaagctggagctcagcgtggacggtgccaagcag
taccggaacggggagtccgtgaagctccacttagaaaccgactccctagccctggtggcg
ctgggagccttggacacagctctgtatgctgcaggcagcaagtcccacaagcccctcaac
atgggcaaggtctttgaagctatgaacagctatgacctcggctgtggtcctgggggtggg
gacagtgcccttcaggtgttccaggcagcgggcctggccttttctgatggagaccagtgg
accttatccagaaagagactaagctgtcccaaggagaagacaacccggaaaaagagaaac
gtgaacttccaaaaggcgattaatgagaaattgggtcagtatgcttccccgacagccaag
cgctgctgccaggatggggtgacacgtctgcccatgatgcgttcctgcgagcagcgggca
gcccgcgtgcagcagccggactgccgggagcccttcctgtcctgctgccaatttgctgag
agtctgcgcaagaagagcagggacaagggccaggcgggcctccaacgagccctggagatc
ctgcaggaggaggacctgattgatgaggatgacattcccgtgcgcagcttcttcccagag
aactggctctggagagtggaaacagtggaccgctttcaaatattgacactgtggctcccc
gactctctgaccacgtgggagatccatggcctgagcctgtccaaaaccaaaggcctatgt
gtggccaccccagtccagctccgggtgttccgcgagttccacctgcacctccgcctgccc
atgtctgtccgccgctttgagcagctggagctgcggcctgtcctctataactacctggat
aaaaacctgactgtgagcgtccacgtgtccccagtggaggggctgtgcctggctgggggc
ggagggctggcccagcaggtgctggtgcctgcgggctctgcccggcctgttgccttctct
gtggtgcccacggcagccaccgctgtgtctctgaaggtggtggctcgagggtccttcgaa
ttccctgtgggagatgcggtgtccaaggttctgcagattgagaaggaaggggccatccat
agagaggagctggtctatgaactcaaccccttggaccaccgaggccggaccttggaaata
cctggcaactctgatcccaatatgatccctgatggggactttaacagctacgtcagggtt
acagcctcagatccattggacactttaggctctgagggggccttgtcaccaggaggcgtg
gcctccctcttgaggcttcctcgaggctgtggggagcaaaccatgatctacttggctccg
acactggctgcttcccgctacctggacaagacagagcagtggagcacactgcctcccgag
accaaggaccacgccgtggatctgatccagaaaggctacatgcggatccagcagtttcgg
aaggcggatggttcctatgcggcttggttgtcacggggcagcagcacctggctcacagcc
tttgtgttgaaggtcctgagtttggcccaggagcaggtaggaggctcgcctgagaaactg
caggagacatctaactggcttctgtcccagcagcaggctgacggctcgttccaggacctc
tctccagtgatacataggagcatgcaggggggtttggtgggcaatgatgagactgtggca
ctcacagcctttgtgaccatcgcccttcatcatgggctggccgtcttccaggatgagggt
gcagagccattgaagcagagagtggaagcctccatctcaaaggcaagctcatttttgggg
gagaaagcaagtgctgggctcctgggtgcccacgcagctgccatcacggcctatgccctg
acactgaccaaggcccctgcggacctgcggggtgttgcccacaacaacctcatggcaatg
gcccaggagactggagataacctgtactggggctcagtcactggttctcagagcaatgcc
gtgtcgcccaccccggctcctcgcaacccatccgaccccatgccccaggccccagccctg
tggattgaaaccacagcctacgccctgctgcacctcctgcttcacgagggcaaagcagag
atggcagaccaggctgcggcctggctcacccgtcagggcagcttccaagggggattccgc
agtacccaagacacggtgattgccctggatgccctgtctgcctactggattgcctcccac
accactgaggagaggggtctcaatgtgactctcagctccacaggccggaatgggttcaag
tcccacgcgctgcagctgaacaaccgccagattcgcggcctggaggaggagctgcagttt
tccttgggcagcaagatcaatgtgaaggtgggaggaaacagcaaaggaaccctgaaggtc
cttcgtacctacaatgtcctggacatgaagaacacgacctgccaggacctacagatagaa
gtgacagtcaaaggccacgtcgagtacacgatggaagcaaacgaggactatgaggactat
gagtacgatgagcttccagccaaggatgacccagatgcccctctgcagcccgtgacaccc
ctgcagctgtttgagggtcggaggaaccgccgcaggagggaggcgcccaaggtggtggag
gagcaggagtccagggtgcactacaccgtgtgcatctggcggaacggcaaggtggggctg
tctggcatggccatcgcggacgtcaccctcctgagtggattccacgccctgcgtgctgac
ctggagaagctgacctccctctctgaccgttacgtgagtcactttgagaccgaggggccc
cacgtcctgctgtattttgactcggtccccacctcccgggagtgcgtgggctttgaggct
gtgcaggaagtgccggtggggctggtgcagccggccagcgcaaccctgtacgactactac
aaccccgagcgcagatgttctgtgttttacggggcaccaagtaagagcagactcttggcc
accttgtgttctgctgaagtctgccagtgtgctgaggggaagtgccctcgccagcgtcgc
gccctggagcggggtctgcaggacgaggatggctacaggatgaagtttgcctgctactac
ccccgtgtggagtacggcttccaggttaaggttctccgagaagacagcagagctgctttc
cgcctctttgagaccaagatcacccaagtcctgcacttcaccaaggatgtcaaggccgct
gctaatcagatgcgcaacttcctggttcgagcctcctgccgccttcgcttggaacctggg
aaagaatatttgatcatgggtctggatggggccacctatgacctcgagggacacccccag
tacctgctggactcgaatagctggatcgaggagatgccctctgaacgcctgtgccggagc
acccgccagcgggcagcctgtgcccagctcaacgacttcctccaggagtatggcactcag
gggtgccaggtgtga

DBGET integrated database retrieval system