KEGG   Homo sapiens (human): 721Help
Entry
721               CDS       T01001                                 

Gene name
C4B, C4B1, C4B12, C4B2, C4B3, C4B5, C4BD, C4B_2, C4F, CH, CO4, CPAMD3
Definition
(RefSeq) complement C4B (Chido blood group)
  KO
K03989  complement component 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
hsa05133  Pertussis
hsa05150  Staphylococcus aureus infection
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    721 (C4B)
 09160 Human Diseases
  09162 Immune diseases
   05322 Systemic lupus erythematosus
    721 (C4B)
  09167 Infectious diseases
   05133 Pertussis
    721 (C4B)
   05150 Staphylococcus aureus infection
    721 (C4B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    721 (C4B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   721 (C4B)
  Exosomal proteins of other cancer cells
   721 (C4B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: A2M_comp A2M_recep A2M A2M_N_2 NTR A2M_N Thiol-ester_cl ANATO Prenyltrans
Motif
Other DBs
NCBI-GeneID: 721
NCBI-ProteinID: NP_001002029
OMIM: 120820
HGNC: 1324
Ensembl: ENSG00000224389
Vega: OTTHUMG00000031187
Pharos: P0C0L5(Tbio) P0C0L4(Tbio)
UniProt: P0C0L4 P0C0L5
Structure
PDB: 

Position
6p21.33
AA seq 1744 aa AA seqDB search
MRLLWGLIWASSFFTLSLQKPRLLLFSPSVVHLGVPLSVGVQLQDVPRGQVVKGSVFLRN
PSRNNVPCSPKVDFTLSSERDFALLSLQVPLKDAKSCGLHQLLRGPEVQLVAHSPWLKDS
LSRTTNIQGINLLFSSRRGHLFLQTDQPIYNPGQRVRYRVFALDQKMRPSTDTITVMVEN
SHGLRVRKKEVYMPSSIFQDDFVIPDISEPGTWKISARFSDGLESNSSTQFEVKKYVLPN
FEVKITPGKPYILTVPGHLDEMQLDIQARYIYGKPVQGVAYVRFGLLDEDGKKTFFRGLE
SQTKLVNGQSHISLSKAEFQDALEKLNMGITDLQGLRLYVAAAIIESPGGEMEEAELTSW
YFVSSPFSLDLSKTKRHLVPGAPFLLQALVREMSGSPASGIPVKVSATVSSPGSVPEVQD
IQQNTDGSGQVSIPIIIPQTISELQLSVSAGSPHPAIARLTVAAPPSGGPGFLSIERPDS
RPPRVGDTLNLNLRAVGSGATFSHYYYMILSRGQIVFMNREPKRTLTSVSVFVDHHLAPS
FYFVAFYYHGDHPVANSLRVDVQAGACEGKLELSVDGAKQYRNGESVKLHLETDSLALVA
LGALDTALYAAGSKSHKPLNMGKVFEAMNSYDLGCGPGGGDSALQVFQAAGLAFSDGDQW
TLSRKRLSCPKEKTTRKKRNVNFQKAINEKLGQYASPTAKRCCQDGVTRLPMMRSCEQRA
ARVQQPDCREPFLSCCQFAESLRKKSRDKGQAGLQRALEILQEEDLIDEDDIPVRSFFPE
NWLWRVETVDRFQILTLWLPDSLTTWEIHGLSLSKTKGLCVATPVQLRVFREFHLHLRLP
MSVRRFEQLELRPVLYNYLDKNLTVSVHVSPVEGLCLAGGGGLAQQVLVPAGSARPVAFS
VVPTAATAVSLKVVARGSFEFPVGDAVSKVLQIEKEGAIHREELVYELNPLDHRGRTLEI
PGNSDPNMIPDGDFNSYVRVTASDPLDTLGSEGALSPGGVASLLRLPRGCGEQTMIYLAP
TLAASRYLDKTEQWSTLPPETKDHAVDLIQKGYMRIQQFRKADGSYAAWLSRGSSTWLTA
FVLKVLSLAQEQVGGSPEKLQETSNWLLSQQQADGSFQDLSPVIHRSMQGGLVGNDETVA
LTAFVTIALHHGLAVFQDEGAEPLKQRVEASISKASSFLGEKASAGLLGAHAAAITAYAL
TLTKAPADLRGVAHNNLMAMAQETGDNLYWGSVTGSQSNAVSPTPAPRNPSDPMPQAPAL
WIETTAYALLHLLLHEGKAEMADQAAAWLTRQGSFQGGFRSTQDTVIALDALSAYWIASH
TTEERGLNVTLSSTGRNGFKSHALQLNNRQIRGLEEELQFSLGSKINVKVGGNSKGTLKV
LRTYNVLDMKNTTCQDLQIEVTVKGHVEYTMEANEDYEDYEYDELPAKDDPDAPLQPVTP
LQLFEGRRNRRRREAPKVVEEQESRVHYTVCIWRNGKVGLSGMAIADVTLLSGFHALRAD
LEKLTSLSDRYVSHFETEGPHVLLYFDSVPTSRECVGFEAVQEVPVGLVQPASATLYDYY
NPERRCSVFYGAPSKSRLLATLCSAEVCQCAEGKCPRQRRALERGLQDEDGYRMKFACYY
PRVEYGFQVKVLREDSRAAFRLFETKITQVLHFTKDVKAAANQMRNFLVRASCRLRLEPG
KEYLIMGLDGATYDLEGHPQYLLDSNSWIEEMPSERLCRSTRQRAACAQLNDFLQEYGTQ
GCQV
NT seq 5235 nt NT seq  +upstreamnt  +downstreamnt
atgaggctgctctgggggctgatctgggcatccagcttcttcaccttatctctgcagaag
cccaggttgctcttgttctctccttctgtggttcatctgggggtccccctatcggtgggg
gtgcagctccaggatgtgccccgaggacaggtagtgaaaggatcagtgttcctgagaaac
ccatctcgtaataatgtcccctgctccccaaaggtggacttcacccttagctcagaaaga
gacttcgcactcctcagtctccaggtgcccttgaaagatgcgaagagctgtggcctccat
caactcctcagaggccctgaggtccagctggtggcccattcgccatggctaaaggactct
ctgtccagaacgacaaacatccagggtatcaacctgctcttctcctctcgccgggggcac
ctctttttgcagacggaccagcccatttacaaccctggccagcgggttcggtaccgggtc
tttgctctggatcagaagatgcgcccgagcactgacaccatcacagtcatggtggagaac
tctcacggcctccgcgtgcggaagaaggaggtgtacatgccctcgtccatcttccaggat
gactttgtgatcccagacatctcagagccagggacctggaagatctcagcccgattctca
gatggcctggaatccaacagcagcacccagtttgaggtgaagaaatatgtccttcccaac
tttgaggtgaagatcacccctggaaagccctacatcctgacggtgccaggccatcttgat
gaaatgcagttagacatccaggccaggtacatctatgggaagccagtgcagggggtggca
tatgtgcgctttgggctcctagatgaggatggtaagaagactttctttcgggggctggag
agtcagaccaagctggtgaatggacagagccacatttccctctcaaaggcagagttccag
gacgccctggagaagctgaatatgggcattactgacctccaggggctgcgcctctacgtt
gctgcagccatcattgagtctccaggtggggagatggaggaggcagagctcacatcctgg
tattttgtgtcatctcccttctccttggatcttagcaagaccaagcgacaccttgtgcct
ggggcccccttcctgctgcaggccttggtccgtgagatgtcaggctccccagcttctggc
attcctgtcaaagtttctgccacggtgtcttctcctgggtctgttcctgaagtccaggac
attcagcaaaacacagacgggagcggccaagtcagcattccaataattatccctcagacc
atctcagagctgcagctctcagtatctgcaggctccccacatccagcgatagccaggctc
actgtggcagccccaccttcaggaggccccgggtttctgtctattgagcggccggattct
cgacctcctcgtgttggggacactctgaacctgaacttgcgagccgtgggcagtggggcc
accttttctcattactactacatgatcctatcccgagggcagatcgtgttcatgaatcga
gagcccaagaggaccctgacctcggtctcggtgtttgtggaccatcacctggcaccctcc
ttctactttgtggccttctactaccatggagaccacccagtggccaactccctgcgagtg
gatgtccaggctggggcctgcgagggcaagctggagctcagcgtggacggtgccaagcag
taccggaacggggagtccgtgaagctccacttagaaaccgactccctagccctggtggcg
ctgggagccttggacacagctctgtatgctgcaggcagcaagtcccacaagcccctcaac
atgggcaaggtctttgaagctatgaacagctatgacctcggctgtggtcctgggggtggg
gacagtgcccttcaggtgttccaggcagcgggcctggccttttctgatggagaccagtgg
accttatccagaaagagactaagctgtcccaaggagaagacaacccggaaaaagagaaac
gtgaacttccaaaaggcgattaatgagaaattgggtcagtatgcttccccgacagccaag
cgctgctgccaggatggggtgacacgtctgcccatgatgcgttcctgcgagcagcgggca
gcccgcgtgcagcagccggactgccgggagcccttcctgtcctgctgccaatttgctgag
agtctgcgcaagaagagcagggacaagggccaggcgggcctccaacgagccctggagatc
ctgcaggaggaggacctgattgatgaggatgacattcccgtgcgcagcttcttcccagag
aactggctctggagagtggaaacagtggaccgctttcaaatattgacactgtggctcccc
gactctctgaccacgtgggagatccatggcctgagcctgtccaaaaccaaaggcctatgt
gtggccaccccagtccagctccgggtgttccgcgagttccacctgcacctccgcctgccc
atgtctgtccgccgctttgagcagctggagctgcggcctgtcctctataactacctggat
aaaaacctgactgtgagcgtccacgtgtccccagtggaggggctgtgcctggctgggggc
ggagggctggcccagcaggtgctggtgcctgcgggctctgcccggcctgttgccttctct
gtggtgcccacggcagccaccgctgtgtctctgaaggtggtggctcgagggtccttcgaa
ttccctgtgggagatgcggtgtccaaggttctgcagattgagaaggaaggggccatccat
agagaggagctggtctatgaactcaaccccttggaccaccgaggccggaccttggaaata
cctggcaactctgatcccaatatgatccctgatggggactttaacagctacgtcagggtt
acagcctcagatccattggacactttaggctctgagggggccttgtcaccaggaggcgtg
gcctccctcttgaggcttcctcgaggctgtggggagcaaaccatgatctacttggctccg
acactggctgcttcccgctacctggacaagacagagcagtggagcacactgcctcccgag
accaaggaccacgccgtggatctgatccagaaaggctacatgcggatccagcagtttcgg
aaggcggatggttcctatgcggcttggttgtcacggggcagcagcacctggctcacagcc
tttgtgttgaaggtcctgagtttggcccaggagcaggtaggaggctcgcctgagaaactg
caggagacatctaactggcttctgtcccagcagcaggctgacggctcgttccaggacctc
tctccagtgatacataggagcatgcaggggggtttggtgggcaatgatgagactgtggca
ctcacagcctttgtgaccatcgcccttcatcatgggctggccgtcttccaggatgagggt
gcagagccattgaagcagagagtggaagcctccatctcaaaggcaagctcatttttgggg
gagaaagcaagtgctgggctcctgggtgcccacgcagctgccatcacggcctatgccctg
acactgaccaaggcccctgcggacctgcggggtgttgcccacaacaacctcatggcaatg
gcccaggagactggagataacctgtactggggctcagtcactggttctcagagcaatgcc
gtgtcgcccaccccggctcctcgcaacccatccgaccccatgccccaggccccagccctg
tggattgaaaccacagcctacgccctgctgcacctcctgcttcacgagggcaaagcagag
atggcagaccaggctgcggcctggctcacccgtcagggcagcttccaagggggattccgc
agtacccaagacacggtgattgccctggatgccctgtctgcctactggattgcctcccac
accactgaggagaggggtctcaatgtgactctcagctccacaggccggaatgggttcaag
tcccacgcgctgcagctgaacaaccgccagattcgcggcctggaggaggagctgcagttt
tccttgggcagcaagatcaatgtgaaggtgggaggaaacagcaaaggaaccctgaaggtc
cttcgtacctacaatgtcctggacatgaagaacacgacctgccaggacctacagatagaa
gtgacagtcaaaggccacgtcgagtacacgatggaagcaaacgaggactatgaggactat
gagtacgatgagcttccagccaaggatgacccagatgcccctctgcagcccgtgacaccc
ctgcagctgtttgagggtcggaggaaccgccgcaggagggaggcgcccaaggtggtggag
gagcaggagtccagggtgcactacaccgtgtgcatctggcggaacggcaaggtggggctg
tctggcatggccatcgcggacgtcaccctcctgagtggattccacgccctgcgtgctgac
ctggagaagctgacctccctctctgaccgttacgtgagtcactttgagaccgaggggccc
cacgtcctgctgtattttgactcggtccccacctcccgggagtgcgtgggctttgaggct
gtgcaggaagtgccggtggggctggtgcagccggccagcgcaaccctgtacgactactac
aaccccgagcgcagatgttctgtgttttacggggcaccaagtaagagcagactcttggcc
accttgtgttctgctgaagtctgccagtgtgctgaggggaagtgccctcgccagcgtcgc
gccctggagcggggtctgcaggacgaggatggctacaggatgaagtttgcctgctactac
ccccgtgtggagtacggcttccaggttaaggttctccgagaagacagcagagctgctttc
cgcctctttgagaccaagatcacccaagtcctgcacttcaccaaggatgtcaaggccgct
gctaatcagatgcgcaacttcctggttcgagcctcctgccgccttcgcttggaacctggg
aaagaatatttgatcatgggtctggatggggccacctatgacctcgagggacacccccag
tacctgctggactcgaatagctggatcgaggagatgccctctgaacgcctgtgccggagc
acccgccagcgggcagcctgtgcccagctcaacgacttcctccaggagtatggcactcag
gggtgccaggtgtga

DBGET integrated database retrieval system