KEGG   Homo sapiens (human): 7220Help
Entry
7220              CDS       T01001                                 

Gene name
TRPC1, HTRP-1, TRP1
Definition
(RefSeq) transient receptor potential cation channel subfamily C member 1
  KO
K04964  transient receptor potential cation channel subfamily C member 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
hsa04724  Glutamatergic synapse
hsa04726  Serotonergic synapse
hsa04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    7220 (TRPC1)
  09156 Nervous system
   04724 Glutamatergic synapse
    7220 (TRPC1)
   04726 Serotonergic synapse
    7220 (TRPC1)
  09158 Development
   04360 Axon guidance
    7220 (TRPC1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    7220 (TRPC1)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   7220 (TRPC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRP_2 Ion_trans Ank_2 Ank_4
Motif
Other DBs
NCBI-GeneID: 7220
NCBI-ProteinID: NP_001238774
OMIM: 602343
HGNC: 12333
Ensembl: ENSG00000144935
Vega: OTTHUMG00000159301
Pharos: P48995(Tbio)
UniProt: P48995
Position
3q23
AA seq 793 aa AA seqDB search
MMAALYPSTDLSGASSSSLPSSPSSSSPNEVMALKDVREVKEENTLNEKLFLLACDKGDY
YMVKKILEENSSGDLNINCVDVLGRNAVTITIENENLDILQLLLDYGCQSADALLVAIDS
EVVGAVDILLNHRPKRSSRPTIVKLMERIQNPEYSTTMDVAPVILAAHRNNYEILTMLLK
QDVSLPKPHAVGCECTLCSAKNKKDSLRHSRFRLDIYRCLASPALIMLTEEDPILRAFEL
SADLKELSLVEVEFRNDYEELARQCKMFAKDLLAQARNSRELEVILNHTSSDEPLDKRGL
LEERMNLSRLKLAIKYNQKEFVSQSNCQQFLNTVWFGQMSGYRRKPTCKKIMTVLTVGIF
WPVLSLCYLIAPKSQFGRIIHTPFMKFIIHGASYFTFLLLLNLYSLVYNEDKKNTMGPAL
ERIDYLLILWIIGMIWSDIKRLWYEGLEDFLEESRNQLSFVMNSLYLATFALKVVAHNKF
HDFADRKDWDAFHPTLVAEGLFAFANVLSYLRLFFMYTTSSILGPLQISMGQMLQDFGKF
LGMFLLVLFSFTIGLTQLYDKGYTSKEQKDCVGIFCEQQSNDTFHSFIGTCFALFWYIFS
LAHVAIFVTRFSYGEELQSFVGAVIVGTYNVVVVIVLTKLLVAMLHKSFQLIANHEDKEW
KFARAKLWLSYFDDKCTLPPPFNIIPSPKTICYMISSLSKWICSHTSKGKVKRQNSLKEW
RNLKQKRDENYQKVMCCLVHRYLTSMRQKMQSTDQATVENLNELRQDLSKFRNEIRDLLG
FRTSKYAMFYPRN
NT seq 2382 nt NT seq  +upstreamnt  +downstreamnt
atgatggcggccctgtacccgagcacggacctctcgggcgcctcctcctcctccctgcct
tcctctccatcctcttcctcgccgaacgaggtgatggcgctgaaggatgtgcgggaggtg
aaggaggagaatacgctgaatgagaagcttttcttgctggcgtgcgacaagggtgactat
tatatggttaaaaagattttggaggaaaacagttcaggtgacttgaacataaattgcgta
gatgtgcttgggagaaatgctgttaccataactattgaaaacgaaaacttggatatactg
cagcttcttttggactacggttgtcagtctgcagatgcacttttggtggcaatcgactct
gaagtagtgggagctgttgatatactacttaatcatcgaccaaaacgatcatcaagacca
actatagtaaaactaatggaacgaattcagaatcctgagtattcaacaactatggatgtt
gcacctgtcattttagctgctcatcgtaacaactatgaaattcttacaatgctcttaaaa
caggatgtatctctacccaagccccatgcagttggctgtgaatgcacattgtgttctgca
aaaaacaaaaaggatagcctccggcattccaggtttcgtcttgatatatatcgatgtttg
gccagtccagctctaataatgttaacagaggaggatccaattctgagagcatttgaactt
agtgctgatttaaaagaactaagtcttgtggaggtggaattcaggaatgattatgaggaa
ctagcccggcaatgtaaaatgtttgctaaggatttacttgcacaagcccggaattctcgt
gaattggaagttattctaaaccatacgtctagtgacgagcctcttgacaaacggggatta
ttagaagaaagaatgaatttaagtcgtctaaaacttgctatcaaatataaccagaaagag
tttgtctcccagtctaactgccagcagttcctgaacactgtttggtttggacagatgtcg
ggttaccgacgcaagcccacctgtaagaagataatgactgttttgacagtaggcatcttt
tggccagttttgtcactttgttatttgatagctcccaaatctcagtttggcagaatcatt
cacacaccttttatgaaatttatcattcatggagcatcatatttcacatttctgctgttg
cttaatctatactctcttgtctacaatgaggataagaaaaacacaatggggccagccctt
gaaagaatagactatcttcttattctgtggattattgggatgatttggtcagacattaaa
agactctggtatgaagggttggaagactttttagaagaatctcgtaatcaactcagtttt
gtcatgaattctctttatttggcaacctttgccctcaaagtggttgctcacaacaagttt
catgattttgctgatcggaaggattgggatgcattccatcctacactggtggcagaaggg
ctttttgcatttgcaaatgttctaagttatcttcgtctcttttttatgtatacaaccagc
tctatcttgggtccattacagatttcaatgggacagatgttacaagattttggaaaattt
cttgggatgtttcttcttgttttgttttctttcacaattggactgacacaactgtatgat
aaaggatatacttcaaaggagcagaaggactgtgtaggcatcttctgtgaacagcaaagc
aatgataccttccattcgttcattggcacctgctttgctttgttctggtatattttctcc
ttagcgcatgtggcaatctttgtcacaagatttagctatggagaagaactgcagtccttt
gtgggagctgtcattgttggtacatacaatgtcgtggttgtgattgtgcttaccaaactg
ctggtggcaatgcttcataaaagctttcagttgatagcaaatcatgaagacaaagaatgg
aagtttgctcgagcaaaattatggcttagctactttgatgacaaatgtacgttacctcca
cctttcaacatcattccctcaccaaagactatctgctatatgattagtagcctcagtaag
tggatttgctctcatacatcaaaaggcaaggtcaaacggcaaaacagtttaaaggaatgg
aggaatttgaaacagaagagagatgaaaactatcaaaaagtgatgtgctgcctagtgcat
cgttacttgacttccatgagacagaagatgcaaagtacagatcaggcaactgtggaaaat
ctaaacgaactgcgccaagatctgtcaaaattccgaaatgaaataagggatttacttggc
tttcggacttctaaatatgctatgttttatccaagaaattaa

DBGET integrated database retrieval system