KEGG   Homo sapiens (human): 723790
Entry
723790            CDS       T01001                                 

Gene name
H2AC19, H2A/R, H2AC18, HIST2H2AA4
Definition
(RefSeq) H2A clustered histone 19
  KO
K11251  histone H2A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa04613  Neutrophil extracellular trap formation
hsa05034  Alcoholism
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    723790 (H2AC19)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    723790 (H2AC19)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    723790 (H2AC19)
  09165 Substance dependence
   05034 Alcoholism
    723790 (H2AC19)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    723790 (H2AC19)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    723790 (H2AC19)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    723790 (H2AC19)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   723790 (H2AC19)
SSDB
Motif
Pfam: Histone_H2A_C Histone CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 723790
NCBI-ProteinID: NP_001035807
HGNC: 29668
Ensembl: ENSG00000272196
Vega: OTTHUMG00000012097
UniProt: Q6FI13
Structure
PDB: 

Position
1q21.2
AA seq 130 aa
MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK
TESHHKAKGK
NT seq 393 nt   +upstreamnt  +downstreamnt
atgtctggtcgtggcaagcaaggaggcaaggcccgcgccaaggccaagtcgcgctcgtcc
cgcgctggccttcagttcccggtagggcgagtgcatcgcttgctgcgcaaaggcaactac
gcggagcgagtgggggccggcgcgcccgtctacatggctgcggtcctcgagtatctgacc
gccgagatcctggagctggcgggcaacgcggctcgggacaacaagaagacgcgcatcatc
cctcgtcacctccagctggccatccgcaacgacgaggaactgaacaagctgctgggcaaa
gtcaccatcgcccagggcggcgtcttgcctaacatccaggccgtactgctccctaagaag
acggagagtcaccacaaggcaaagggcaagtga

DBGET integrated database retrieval system