KEGG   Homo sapiens (human): 7301Help
Entry
7301              CDS       T01001                                 

Gene name
TYRO3, BYK, Dtk, Etk-2, RSE, Rek, Sky, Tif
Definition
(RefSeq) TYRO3 protein tyrosine kinase
  KO
K05116  TYRO3 protein tyrosine kinase 3 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Drug target
Cabozantinib (DG01670): D10062 D10095
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    7301 (TYRO3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     7301 (TYRO3)
Protein kinases [BR:hsa01001]
 Receptor tyrosine kinases (RTK)
  AXL family
   7301 (TYRO3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Ig_3 Ig_2 fn3 I-set ig V-set DUF4229 C1-set Kinase-like
Motif
Other DBs
NCBI-GeneID: 7301
NCBI-ProteinID: NP_006284
OMIM: 600341
HGNC: 12446
Ensembl: ENSG00000092445
Vega: OTTHUMG00000130341
Pharos: Q06418(Tchem)
UniProt: Q06418
Structure
PDB: 

Position
15q15.1
AA seq 890 aa AA seqDB search
MALRRSMGRPGLPPLPLPPPPRLGLLLAALASLLLPESAAAGLKLMGAPVKLTVSQGQPV
KLNCSVEGMEEPDIQWVKDGAVVQNLDQLYIPVSEQHWIGFLSLKSVERSDAGRYWCQVE
DGGETEISQPVWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGPPEPVTIVWWRGTTKI
GGPAPSPSVLNVTGVTQSTMFSCEAHNLKGLASSRTATVHLQALPAAPFNITVTKLSSSN
ASVAWMPGADGRALLQSCTVQVTQAPGGWEVLAVVVPVPPFTCLLRDLVPATNYSLRVRC
ANALGPSPYADWVPFQTKGLAPASAPQNLHAIRTDSGLILEWEEVIPEAPLEGPLGPYKL
SWVQDNGTQDELTVEGTRANLTGWDPQKDLIVRVCVSNAVGCGPWSQPLVVSSHDRAGQQ
GPPHSRTSWVPVVLGVLTALVTAAALALILLRKRRKETRFGQAFDSVMARGEPAVHFRAA
RSFNRERPERIEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQE
DGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPM
VILPFMKHGDLHAFLLASRIGENPFNLPLQTLIRFMVDIACGMEYLSSRNFIHRDLAARN
CMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVQSDVWAFGV
TMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECMEDVYDLMYQCWSADPKQRPSFT
CLRMELENILGQLSVLSASQDPLYINIERAEEPTAGGSLELPGRDQPYSGAGDGSGMGAV
GGTPSDCRYILTPGGLAEQPGQAEHQPESPLNETQRLLLLQQGLLPHSSC
NT seq 2673 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgaggcggagcatggggcggccggggctcccgccgctgccgctgccgccgcca
ccgcggctcgggctgctgctggcggctctggcttctctgctgctcccggagtccgccgcc
gcaggtctgaagctcatgggagccccggtgaagctgacagtgtctcaggggcagccggtg
aagctcaactgcagtgtggaggggatggaggagcctgacatccagtgggtgaaggatggg
gctgtggtccagaacttggaccagttgtacatcccagtcagcgagcagcactggatcggc
ttcctcagcctgaagtcagtggagcgctctgacgccggccggtactggtgccaggtggag
gatgggggtgaaaccgagatctcccagccagtgtggctcacggtagaaggtgtgccattt
ttcacagtggagccaaaagatctggcagtgccacccaatgcccctttccaactgtcttgt
gaggctgtgggtccccctgaacctgttaccattgtctggtggagaggaactacgaagatc
gggggacccgctccctctccatctgttttaaatgtaacaggggtgacccagagcaccatg
ttttcctgtgaagctcacaacctaaaaggcctggcctcttctcgcacagccactgttcac
cttcaagcactgcctgcagcccccttcaacatcaccgtgacaaagctttccagcagcaac
gctagtgtggcctggatgccaggtgctgatggccgagctctgctacagtcctgtacagtt
caggtgacacaggccccaggaggctgggaagtcctggctgttgtggtccctgtgcccccc
tttacctgcctgctccgggacctggtgcctgccaccaactacagcctcagggtgcgctgt
gccaatgccttggggccctctccctatgctgactgggtgccctttcagaccaagggtcta
gccccagccagcgctccccaaaacctccatgccatccgcacagattcaggcctcatcttg
gagtgggaagaagtgatccccgaggcccctttggaaggccccctgggaccctacaaactg
tcctgggttcaagacaatggaacccaggatgagctgacagtggaggggaccagggccaat
ttgacaggctgggatccccaaaaggacctgatcgtacgtgtgtgcgtctccaatgcagtt
ggctgtggaccctggagtcagccactggtggtctcttctcatgaccgtgcaggccagcag
ggccctcctcacagccgcacatcctgggtacctgtggtccttggtgtgctaacggccctg
gtgacggctgctgccctggccctcatcctgcttcgaaagagacggaaagagacgcggttt
gggcaagcctttgacagtgtcatggcccggggagagccagccgttcacttccgggcagcc
cggtccttcaatcgagaaaggcccgagcgcatcgaggccacattggacagcttgggcatc
agcgatgaactaaaggaaaaactggaggatgtgctcatcccagagcagcagttcaccctg
ggccggatgttgggcaaaggagagtttggttcagtgcgggaggcccagctgaagcaagag
gatggctcctttgtgaaagtggctgtgaagatgctgaaagctgacatcattgcctcaagc
gacattgaagagttcctcagggaagcagcttgcatgaaggagtttgaccatccacacgtg
gccaaacttgttggggtaagcctccggagcagggctaaaggccgtctccccatccccatg
gtcatcttgcccttcatgaagcatggggacctgcatgccttcctgctcgcctcccggatt
ggggagaacccctttaacctacccctccagaccctgatccggttcatggtggacattgcc
tgcggcatggagtacctgagctctcggaacttcatccaccgagacctggctgctcggaat
tgcatgctggcagaggacatgacagtgtgtgtggctgacttcggactctcccggaagatc
tacagtggggactactatcgtcaaggctgtgcctccaaactgcctgtcaagtggctggcc
ctggagagcctggccgacaacctgtatactgtgcagagtgacgtgtgggcgttcggggtg
accatgtgggagatcatgacacgtgggcagacgccatatgctggcatcgaaaacgctgag
atttacaactacctcattggcgggaaccgcctgaaacagcctccggagtgtatggaggac
gtgtatgatctcatgtaccagtgctggagtgctgaccccaagcagcgcccgagctttact
tgtctgcgaatggaactggagaacatcttgggccagctgtctgtgctatctgccagccag
gaccccttatacatcaacatcgagagagctgaggagcccactgcgggaggcagcctggag
ctacctggcagggatcagccctacagtggggctggggatggcagtggcatgggggcagtg
ggtggcactcccagtgactgtcggtacatactcacccccggagggctggctgagcagcca
gggcaggcagagcaccagccagagagtcccctcaatgagacacagaggcttttgctgctg
cagcaagggctactgccacacagtagctgttag

DBGET integrated database retrieval system