KEGG   Homo sapiens (human): 7314
Entry
7314              CDS       T01001                                 
Symbol
UBB, HEL-S-50
Name
(RefSeq) ubiquitin B
  KO
K04551  ubiquitin B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04137  Mitophagy - animal
hsa05012  Parkinson disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05131  Shigellosis
hsa05167  Kaposi sarcoma-associated herpesvirus infection
Network
nt06420  Ubiquitin-proteasome system
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
nt06465  Prion disease
  Element
N01027  UCHL1-mediated hydrolysis
N01028  Mutation-inactivated UCHL1 to UCHL1-mediated hydrolysis
N01029  26S proteasome-mediated protein degradation
N01144  Mutation-caused aberrant SOD1 to 26S proteasome-mediated protein degradation
N01145  Mutation-inactivated VCP to 26S proteasome-mediated protein degradation
N01146  Mutation-inactivated UBQLN2 to 26S proteasome-mediated protein degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    7314 (UBB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    7314 (UBB)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    7314 (UBB)
  09171 Infectious disease: bacterial
   05131 Shigellosis
    7314 (UBB)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    7314 (UBB)
   05022 Pathways of neurodegeneration - multiple diseases
    7314 (UBB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    7314 (UBB)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    7314 (UBB)
Ubiquitin system [BR:hsa04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitins
   7314 (UBB)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   7314 (UBB)
  Exosomal proteins of other body fluids (saliva and urine)
   7314 (UBB)
  Exosomal proteins of colorectal cancer cells
   7314 (UBB)
  Exosomal proteins of bladder cancer cells
   7314 (UBB)
SSDB
Motif
Pfam: ubiquitin Rad60-SLD Ubiquitin_2 TBK1_ULD Rad60-SLD_2 DUF2604 Ubiquitin_5 Dsc3_N
Other DBs
NCBI-GeneID: 7314
NCBI-ProteinID: NP_001268645
OMIM: 191339
HGNC: 12463
Ensembl: ENSG00000170315
Pharos: P0CG47(Tbio)
UniProt: P0CG47 Q5U5U6
Structure
Position
17:16380779..16382745
AA seq 229 aa
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI
FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA
KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGC
NT seq 690 nt   +upstreamnt  +downstreamnt
atgcagatcttcgtgaaaacccttaccggcaagaccatcacccttgaggtggagcccagt
gacaccatcgaaaatgtgaaggccaagatccaggataaggaaggcattccccccgaccag
cagaggctcatctttgcaggcaagcagctggaagatggccgtactctttctgactacaac
atccagaaggagtcgaccctgcacctggtcctgcgtctgagaggtggtatgcagatcttc
gtgaagaccctgaccggcaagaccatcaccctggaagtggagcccagtgacaccatcgaa
aatgtgaaggccaagatccaggataaagaaggcatccctcccgaccagcagaggctcatc
tttgcaggcaagcagctggaagatggccgcactctttctgactacaacatccagaaggag
tcgaccctgcacctggtcctgcgtctgagaggtggtatgcagatcttcgtgaagaccctg
accggcaagaccatcactctggaggtggagcccagtgacaccatcgaaaatgtgaaggcc
aagatccaagataaagaaggcatcccccccgaccagcagaggctcatctttgcaggcaag
cagctggaagatggccgcactctttctgactacaacatccagaaagagtcgaccctgcac
ctggtcctgcgcctgaggggtggctgttaa

DBGET integrated database retrieval system