KEGG   Homo sapiens (human): 7314Help
Entry
7314              CDS       T01001                                 

Gene name
UBB, HEL-S-50
Definition
(RefSeq) ubiquitin B
  KO
K04551  ubiquitin B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04137  Mitophagy - animal
hsa04144  Endocytosis
hsa05012  Parkinson disease
hsa05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    7314 (UBB)
   04137 Mitophagy - animal
    7314 (UBB)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05012 Parkinson disease
    7314 (UBB)
  09172 Infectious diseases: Viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    7314 (UBB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    7314 (UBB)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    7314 (UBB)
Ubiquitin system [BR:hsa04121]
 Ubiquitins and Ubiquitin-like proteins
  Ubiquitins
   7314 (UBB)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   7314 (UBB)
  Exosomal proteins of other body fluids (saliva and urine)
   7314 (UBB)
  Exosomal proteins of colorectal cancer cells
   7314 (UBB)
  Exosomal proteins of bladder cancer cells
   7314 (UBB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ubiquitin Rad60-SLD Ubiquitin_2 TBK1_ULD Rad60-SLD_2 Ubiquitin_5 DUF2407
Motif
Other DBs
NCBI-GeneID: 7314
NCBI-ProteinID: NP_001268645
OMIM: 191339
HGNC: 12463
Ensembl: ENSG00000170315
Vega: OTTHUMG00000058987
Pharos: P0CG47(Tbio)
UniProt: P0CG47 Q5U5U6
Structure
PDB: 
5NVG 5GOB 5GOD 4XOF 5W46 3NHE 5NL4 5DK8 1OGW 5V1Y 5KYC 5KYF 4IUM 1XD3 5YT6 5NLF 4PIH 4PIJ 4UN2 5NLI 5NLJ 4V3L 4ZPZ 5GOJ 5K9P 5J8P 3BY4 2GBM 5GOI 6FDK 5OXH 2ZCB 2GBN 5KYD 5OXI 4K1R 5X3N 5EMZ 5AF5 6B7M 5NMC 4I6N 3VUX 3V6C 3B08 3PRP 3NS8 4ZFR 6EI1 5GOC 6FGE 4MSM 4K7S 4K7U 4K7W 5M93 3N32 6GLC 5ULF 5GO7 4ZQS 3ONS 3K9O 1UBI 1UBQ 3EHV 5X3M 5TXK 5GOK 3EFU 6B7O 5WFI 5L8H 5AF4 3ALB 3MHS 5CVM 4WZP 4LDT 3ZNZ 3B0A 3H7P 5D0M 3TMP 5ULH 5GOH 4PIG 4MSQ 3VUW 2JF5 5NL5 3HM3 5KYE 5GOG 3VUY 5JBY 2GBK 2G45 5YDR 5V1Z 5WVO 5LRW 4WLR 4IG7 3PHW 2GBR 1S1Q 4V3K 4PQT 4FJV 6AQR 5JBV 5DFL 4XKL 3V6E 4RF1 5MNJ 5ZQ3 4AUQ 5X3O 3AXC 3NOB 5IFR 4XOK 2XEW 3A33 2O6V 2IBI 5GO8 5AIU 3ZNI 4AP4 5ZQ4 2W9N 5XPK 5VZW 4R62 4ZFT 4UEL 3WXF 3ZNH 3PRM 3H7S 2WDT 1NBF 3C0R 5OHK 4BOS 4DHJ 3UGB 3OFI 6ASR 5XDP 5ULK 3AUL 5EYA 4KSK 3IFW 1TBE 3U30 5ZQ5 5BNB 5OHL 3WXE 3RUL 3PT2 3OJ3 2GMI 5YDK 5H07 3I3T 5N38 5TUT 3DVG 2OJR 4MDK 5CAW 5CRA 5D0K 5N2W 4BVU 2Y5B 3PTF 3O65 3MTN 3JSV 3DVN 2HTH 1F9J 4MM3 5L8W 5OHV 5OHP 5LRV 4RF0 3VFK 3KVF 3K9P 3IHP 4KSL 3KW5 5ZQ7 5LRX 4HXD 6CP2 5JP3 4JQW 3ZLZ 3TBL 2ZVO 4XOL 5OE7 5WQ4 3PHD 2XK5 3N30 2ZVN 3EEC 5ZQ6 4S1Z 4BOZ 6EQI 5YIK 4LCD 3JW0 4DHZ 6DC6 5O44 5LN1 4WUR 5YIJ 5UDH 4DDG 3JVZ 5JTV 5JTJ 5CVN 5AF6 4P4H 3OJ4 5VNZ 5EDV 5H7S 5KHY 2AYO 5OHN 4JIO 4UF6 4NQK 4DDI 4ZUX 5CVO 5VO0 6FTX 5GJQ 5KGF 4WHV 5A5B 5VZM 5XK4 5XK5 5VEY 5VF0 5XBO 5UJL 5UJN 2NBD 2NBE 2N3U 2N3V 2N3W 2N2K 2N13 2MWS 2MUR 2MSG 2MRO 2MRE 2MOR 2MJB 2MJ5 2RU6 2MCN 2MBQ 2MBO 2MBH 2MBB 2LZ6 2LVO 2LVP 2LVQ 2RSU 2LJ5 2LD9 2L3Z 2L0T 2L0F 2RR9 2KX0 2KWV 2KWU 2KTF 2KOX 2KN5 2KLG 2KJH 2KHW 2KDF 2K8B 2K8C 2K6D 2K25 2JZZ 2JY6 2Z59 2JRI 2PE9 2PEA 2NR2 2J7Q 2DEN 1ZGU 1YX5 1YX6 2BGF 1XQQ 1Q5W 1GJZ 1G6J 1FXT 1D3Z
Thumbnails

Position
17p11.2
AA seq 229 aa AA seqDB search
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI
FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA
KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGC
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgcagatcttcgtgaaaacccttaccggcaagaccatcacccttgaggtggagcccagt
gacaccatcgaaaatgtgaaggccaagatccaggataaggaaggcattccccccgaccag
cagaggctcatctttgcaggcaagcagctggaagatggccgtactctttctgactacaac
atccagaaggagtcgaccctgcacctggtcctgcgtctgagaggtggtatgcagatcttc
gtgaagaccctgaccggcaagaccatcaccctggaagtggagcccagtgacaccatcgaa
aatgtgaaggccaagatccaggataaagaaggcatccctcccgaccagcagaggctcatc
tttgcaggcaagcagctggaagatggccgcactctttctgactacaacatccagaaggag
tcgaccctgcacctggtcctgcgtctgagaggtggtatgcagatcttcgtgaagaccctg
accggcaagaccatcactctggaggtggagcccagtgacaccatcgaaaatgtgaaggcc
aagatccaagataaagaaggcatcccccccgaccagcagaggctcatctttgcaggcaag
cagctggaagatggccgcactctttctgactacaacatccagaaagagtcgaccctgcac
ctggtcctgcgcctgaggggtggctgttaa

DBGET integrated database retrieval system