KEGG   Homo sapiens (human): 7326
Entry
7326              CDS       T01001                                 

Symbol
UBE2G1, E217K, UBC7, UBE2G
Name
(RefSeq) ubiquitin conjugating enzyme E2 G1
  KO
K10575  ubiquitin-conjugating enzyme E2 G1 [EC:2.3.2.23]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04141  Protein processing in endoplasmic reticulum
hsa05012  Parkinson disease
hsa05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    7326 (UBE2G1)
   04120 Ubiquitin mediated proteolysis
    7326 (UBE2G1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    7326 (UBE2G1)
   05022 Pathways of neurodegeneration - multiple diseases
    7326 (UBE2G1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    7326 (UBE2G1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     7326 (UBE2G1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   7326 (UBE2G1)
SSDB
Motif
Pfam: UQ_con RWD
Other DBs
NCBI-GeneID: 7326
NCBI-ProteinID: NP_003333
OMIM: 601569
HGNC: 12482
Ensembl: ENSG00000132388
Vega: OTTHUMG00000177826
Pharos: P62253(Tbio)
UniProt: P62253
Structure
PDB: 
2AWF 6D68

Position
17p13.2
AA seq 170 aa
MTELQSALLLRRQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKAHLT
FPKDYPLRPPKMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIHTVETI
MISVISMLADPNGDSPANVDAAKEWREDRNGEFKRKVARCVRKSQETAFE
NT seq 513 nt   +upstreamnt  +downstreamnt
atgacggagctgcagtcggcactgctactgcgaagacagctggcagaactcaacaaaaat
ccagtggaaggcttttctgcaggtttaatagatgacaatgatctctaccgatgggaagtc
cttattattggccctccagatacactttatgaaggtggtgtttttaaggctcatcttact
ttcccaaaagattatcccctccgacctcctaaaatgaaattcattacagaaatctggcac
ccaaatgttgataaaaatggtgatgtgtgcatttctattcttcatgagcctggggaagat
aagtatggttatgaaaagccagaggaacgctggctccctatccacactgtggaaaccatc
atgattagtgtcatttctatgctggcagaccctaatggagactcacctgctaatgttgat
gctgcgaaagaatggagggaagatagaaatggagaatttaaaagaaaagttgcccgctgt
gtaagaaaaagccaagagactgcttttgagtga

KEGG   Homo sapiens (human): 7327
Entry
7327              CDS       T01001                                 

Symbol
UBE2G2, UBC7
Name
(RefSeq) ubiquitin conjugating enzyme E2 G2
  KO
K04555  ubiquitin-conjugating enzyme E2 G2 [EC:2.3.2.23]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04141  Protein processing in endoplasmic reticulum
hsa05012  Parkinson disease
hsa05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    7327 (UBE2G2)
   04120 Ubiquitin mediated proteolysis
    7327 (UBE2G2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    7327 (UBE2G2)
   05022 Pathways of neurodegeneration - multiple diseases
    7327 (UBE2G2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    7327 (UBE2G2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     7327 (UBE2G2)
Ubiquitin system [BR:hsa04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   7327 (UBE2G2)
SSDB
Motif
Pfam: UQ_con
Other DBs
NCBI-GeneID: 7327
NCBI-ProteinID: NP_003334
OMIM: 603124
HGNC: 12483
Ensembl: ENSG00000184787
Vega: OTTHUMG00000089179
Pharos: P60604(Tbio)
UniProt: P60604
Structure
PDB: 
3H8K 4LAD 2CYX 2LXP 2KLY

Position
21q22.3
AA seq 165 aa
MAGTALKRLMAEYKQLTLNPPEGIVAGPMNEENFFEWEALIMGPEDTCFEFGVFPAILSF
PLDYPLSPPKMRFTCEMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKIL
LSVVSMLAEPNDESGANVDASKMWRDDREQFYKIAKQIVQKSLGL
NT seq 498 nt   +upstreamnt  +downstreamnt
atggcggggaccgcgctcaagaggctgatggccgagtacaaacaattaacactgaatcct
ccggaaggaattgtagcaggccccatgaatgaagagaacttttttgaatgggaggcattg
atcatgggcccagaagacacctgctttgagtttggtgtttttcctgccatcctgagtttc
ccacttgattacccgttaagtcccccaaagatgagatttacctgtgagatgtttcatccc
aacatctaccctgatgggagagtctgcatttccatcctccacgcgccaggcgatgacccc
atgggctacgagagcagcgcggagcggtggagtcctgtgcagagtgtggagaagatcctg
ctgtcggtggtgagcatgctggcagagcccaatgacgaaagtggagctaacgtggatgcg
tccaaaatgtggcgcgatgaccgggagcagttctataagattgccaagcagatcgtccag
aagtctctgggactgtga

DBGET integrated database retrieval system