KEGG   Homo sapiens (human): 7392Help
Entry
7392              CDS       T01001                                 

Gene name
USF2, FIP, bHLHb12
Definition
(RefSeq) upstream transcription factor 2, c-fos interacting
  KO
K09106  upstream stimulatory factor
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    7392 (USF2)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Ubiquitous bHLH-ZIP factors
    7392 (USF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HLH DUF2353 YabA DUF2100 UPF0242 Rx_N MCC-bdg_PDZ T3SS_TC
Motif
Other DBs
NCBI-GeneID: 7392
NCBI-ProteinID: NP_003358
OMIM: 600390
HGNC: 12594
Ensembl: ENSG00000105698
Vega: OTTHUMG00000183182
Pharos: Q15853(Tbio)
UniProt: Q15853
Position
19q13.12
AA seq 346 aa AA seqDB search
MDMLDPGLDPAASATAAAAASHDKGPEAEEGVELQEGGDGPGAEEQTAVAITSVQQAAFG
DHNIQYQFRTETNGGQVTYRVVQVTDGQLDGQGDTAGAVSVVSTAAFAGGQQAVTQVGVD
GAAQRPGPAAASVPPGPAAPFPLAVIQNPFSNGGSPAAEAVSGEARFAYFPASSVGDTTA
VSVQTTDQSLQAGGQFYVMMTPQDVLQTGTQRTIAPRTHPYSPKIDGTRTPRDERRRAQH
NEVERRRRDKINNWIVQLSKIIPDCNADNSKTGASKGGILSKACDYIRELRQTNQRMQET
FKEAERLQMDNELLRQQIEELKNENALLRAQLQQHNLEMVGEGTRQ
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggacatgctggacccgggtctggatcccgctgcctcggccaccgctgctgccgccgcc
agccacgacaagggacccgaggcggaggagggcgtcgagctgcaggaaggcggggacggc
ccaggagcggaggagcagacagcggtggccatcaccagcgtccagcaggcggcgttcggc
gaccacaacatccagtaccagttccgcacagagacaaatggaggacaggtgacataccgc
gtagtccaggtgactgatggtcagctggacggccagggcgacacagctggcgccgtcagc
gtcgtgtccaccgctgccttcgcgggggggcagcaggctgtgacccaggtgggtgtggac
ggggcagcccagcgcccgggccccgccgctgcctctgtgcccccaggtcctgcagcgccc
ttcccgctggctgtgatccaaaatcccttcagcaatggtggcagtccggcggccgaggct
gtcagcggggaggcacgatttgcctatttcccagcgtccagtgtgggagatactacggct
gtgtccgtacagaccacagaccagagcttgcaggctggaggccagttctacgtcatgatg
acgccccaggatgtgcttcagacaggaacacagaggacgatcgccccccggacacaccct
tactctccaaaaattgatggaaccagaacaccccgagatgagaggagaagagcccagcac
aacgaagtggagcggaggcggagggacaagatcaacaactggatcgtccagctttcgaaa
atcattccagactgtaacgcagacaacagcaagacgggagcgagtaaaggagggatcctg
tccaaggcctgcgattacatccgggagttgcgccagaccaaccagcgcatgcaggagacc
ttcaaagaggccgagcggctgcagatggacaacgagctcctgaggcagcagatcgaggag
ctgaagaatgagaacgccctgcttcgagcccagctgcagcagcacaacctggagatggtg
ggcgagggcacccggcagtga

DBGET integrated database retrieval system