KEGG   Homo sapiens (human): 7422Help
Entry
7422              CDS       T01001                                 

Gene name
VEGFA, MVCD1, VEGF, VPF
Definition
(RefSeq) vascular endothelial growth factor A
  KO
K05448  vascular endothelial growth factor A
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04066  HIF-1 signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04370  VEGF signaling pathway
hsa04510  Focal adhesion
hsa04926  Relaxin signaling pathway
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05163  Human cytomegalovirus infection
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05206  MicroRNAs in cancer
hsa05211  Renal cell carcinoma
hsa05212  Pancreatic cancer
hsa05219  Bladder cancer
hsa05323  Rheumatoid arthritis
hsa05418  Fluid shear stress and atherosclerosis
Network
N00079  HIF-1 signaling pathway
N00080  Loss of VHL to HIF-1 signaling pathway
N00081  Mutation-inactivated VHL to HIF-1 signaling pathway
N00095  ERBB2-overexpression to EGF-Jak-STAT signaling pathway
N00157  KSHV vGPCR to GNB/G-ERK signaling pathway
N00179  KSHV K1 to PI3K-NFKB signaling pathway
Disease
H01456  Diabetic nephropathy
H01457  Diabetic retinopathy
H01459  Diabetic neuropathy
H01529  Avascular necrosis of femoral head
H01709  Glucocorticoid-induced osteonecrosis
Drug target
Aflibercept: D09574
Aflibercept beta: D10819
Bevacizumab: D06409
Bevasiranib sodium: D08874
Brolucizumab: D11083
Navicixizumab: D11126
Pegaptanib: D05386
Ranibizumab: D05697
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    7422 (VEGFA)
   04015 Rap1 signaling pathway
    7422 (VEGFA)
   04010 MAPK signaling pathway
    7422 (VEGFA)
   04370 VEGF signaling pathway
    7422 (VEGFA)
   04066 HIF-1 signaling pathway
    7422 (VEGFA)
   04151 PI3K-Akt signaling pathway
    7422 (VEGFA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    7422 (VEGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    7422 (VEGFA)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    7422 (VEGFA)
   05206 MicroRNAs in cancer
    7422 (VEGFA)
   05205 Proteoglycans in cancer
    7422 (VEGFA)
  09162 Cancers: Specific types
   05212 Pancreatic cancer
    7422 (VEGFA)
   05211 Renal cell carcinoma
    7422 (VEGFA)
   05219 Bladder cancer
    7422 (VEGFA)
  09163 Immune diseases
   05323 Rheumatoid arthritis
    7422 (VEGFA)
  09166 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    7422 (VEGFA)
  09167 Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    7422 (VEGFA)
  09172 Infectious diseases: Viral
   05163 Human cytomegalovirus infection
    7422 (VEGFA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    7422 (VEGFA)
   05165 Human papillomavirus infection
    7422 (VEGFA)
  09176 Drug resistance: Antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    7422 (VEGFA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    7422 (VEGFA)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    7422 (VEGFA)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   7422 (VEGFA)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Growth factors/receptors
   7422 (VEGFA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VEGF_C PDGF
Motif
Other DBs
NCBI-GeneID: 7422
NCBI-ProteinID: NP_001165094
OMIM: 192240
HGNC: 12680
Ensembl: ENSG00000112715
Vega: OTTHUMG00000014745
Pharos: P15692(Tclin)
UniProt: P15692 A0A024RD33
Structure
PDB: 

Position
6p21.1
AA seq 232 aa AA seqDB search
MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVD
IFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEM
SFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVYVGARCCLMPWSLPG
PHPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgaactttctgctgtcttgggtgcattggagccttgccttgctgctctacctccaccat
gccaagtggtcccaggctgcacccatggcagaaggaggagggcagaatcatcacgaagtg
gtgaagttcatggatgtctatcagcgcagctactgccatccaatcgagaccctggtggac
atcttccaggagtaccctgatgagatcgagtacatcttcaagccatcctgtgtgcccctg
atgcgatgcgggggctgctgcaatgacgagggcctggagtgtgtgcccactgaggagtcc
aacatcaccatgcagattatgcggatcaaacctcaccaaggccagcacataggagagatg
agcttcctacagcacaacaaatgtgaatgcagaccaaagaaagatagagcaagacaagaa
aaaaaatcagttcgaggaaagggaaaggggcaaaaacgaaagcgcaagaaatcccggtat
aagtcctggagcgtgtacgttggtgcccgctgctgtctaatgccctggagcctccctggc
ccccatccctgtgggccttgctcagagcggagaaagcatttgtttgtacaagatccgcag
acgtgtaaatgttcctgcaaaaacacagactcgcgttgcaaggcgaggcagcttgagtta
aacgaacgtacttgcagatgtgacaagccgaggcggtga

DBGET integrated database retrieval system