KEGG   Homo sapiens (human): 7515
Entry
7515              CDS       T01001                                 
Symbol
XRCC1, RCC, SCAR26
Name
(RefSeq) X-ray repair cross complementing 1
  KO
K10803  DNA-repair protein XRCC1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03410  Base excision repair
Network
nt06502  Nucleotide excision repair
nt06504  Base excision repair
  Element
N01431  Core NER reaction
N01434  Base excision and strand cleavage by bifunctional glycosylase
N01435  Base excision and strand cleavage by NEIL glycosylase
N01437  Short patch BER
Disease
H01891  Autosomal recessive spinocerebellar ataxias
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    7515 (XRCC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    7515 (XRCC1)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Short Patch-BER factors
     7515 (XRCC1)
SSDB
Motif
Pfam: XRCC1_N BRCT BRCT_2 PTCB-BRCT LIG3_BRCT
Other DBs
NCBI-GeneID: 7515
NCBI-ProteinID: NP_006288
OMIM: 194360
HGNC: 12828
Ensembl: ENSG00000073050
Pharos: P18887(Tbio)
UniProt: P18887 B2RCY5 Q59HH7
Structure
Position
19:complement(43543311..43575527)
AA seq 633 aa
MPEIRLRHVVSCSSQDSTHCAENLLKADTYRKWRAAKAGEKTISVVLQLEKEEQIHSVDI
GNDGSAFVEVLVGSSAGGAGEQDYEVLLVTSSFMSPSESRSGSNPNRVRMFGPDKLVRAA
AEKRWDRVKIVCSQPYSKDSPFGLSFVRFHSPPDKDEAEAPSQKVTVTKLGQFRVKEEDE
SANSLRPGALFFSRINKTSPVTASDPAGPSYAAATLQASSAASSASPVSRAIGSTSKPQE
SPKGKRKLDLNQEEKKTPSKPPAQLSPSVPKRPKLPAPTRTPATAPVPARAQGAVTGKPR
GEGTEPRRPRAGPEELGKILQGVVVVLSGFQNPFRSELRDKALELGAKYRPDWTRDSTHL
ICAFANTPKYSQVLGLGGRIVRKEWVLDCHRMRRRLPSQRYLMAGPGSSSEEDEASHSGG
SGDEAPKLPQKQPQTKTKPTQAAGPSSPQKPPTPEETKAASPVLQEDIDIEGVQSEGQDN
GAEDSGDTEDELRRVAEQKEHRLPPGQEENGEDPYAGSTDENTDSEEHQEPPDLPVPELP
DFFQGKHFFLYGEFPGDERRKLIRYVTAFNGELEDYMSDRVQFVITAQEWDPSFEEALMD
NPSLAFVRPRWIYSCNEKQKLLPHQLYGVVPQA
NT seq 1902 nt   +upstreamnt  +downstreamnt
atgccggagatccgcctccgccatgtcgtgtcctgcagcagccaggactcgactcactgt
gcagaaaatcttctcaaggcagacacttaccgaaaatggcgggcagccaaggcaggcgag
aagaccatctctgtggtcctacagttggagaaggaggagcagatacacagtgtggacatt
gggaatgatggctcagctttcgtggaggtgctggtgggcagttcagctggaggcgctggg
gagcaagactatgaggtccttctggtcacctcatctttcatgtccccttccgagagccgc
agtggctcaaaccccaaccgcgttcgcatgtttgggcctgacaagctggtccgggcagcc
gccgagaagcgctgggaccgggtcaaaattgtttgcagccagccctacagcaaggactcc
ccctttggcttgagttttgtacggtttcatagccccccagacaaagatgaggcagaggcc
ccgtcccagaaggtgacagtgaccaagcttggccagttccgtgtgaaggaggaggatgag
agcgccaactctctgaggccgggggctctcttcttcagccggatcaacaagacatcccca
gtcacagccagcgacccagcaggacctagctatgcagctgctaccctccaggcttctagt
gctgcctcctcagcctctccagtctccagggccataggcagcacctccaagccccaggag
tctcccaaagggaagaggaagttggatttgaaccaagaagaaaagaagacccccagcaaa
ccaccagcccagctgtcgccatctgttcccaagagacctaaattgccagctccaactcgt
accccagccacagccccagtccctgcccgagcacagggggcagtgacaggcaaaccccga
ggagaaggcaccgagcccagacgaccccgagctggcccagaggagctggggaagatcctt
cagggtgtggtagtggtgctgagtggcttccagaaccccttccgctccgagctgcgagat
aaggccctagagcttggggccaagtatcggccagactggacccgggacagcacgcacctc
atctgtgcctttgccaacacccccaagtacagccaggtcctaggcctgggaggccgcatc
gtgcgtaaggagtgggtgctggactgtcaccgcatgcgtcggcggctgccctcccagagg
tacctcatggcagggccaggttccagcagtgaggaggatgaggcctctcacagcggtggc
agcggagatgaagcccccaagcttcctcagaagcaaccccagaccaaaaccaagcccact
caggcagctggacccagctcaccccagaagcccccaacccctgaagagaccaaagcagcc
tcaccagtgctccaggaagatatagacattgagggggtacagtcagaaggacaggacaat
ggggcggaagattctggggacacagaggatgagctgaggagggtggcagagcagaaggaa
cacagactgccccctggccaggaggagaatggggaagacccgtatgcaggctccacggat
gagaacacggacagtgaggaacaccaggagcctcctgatctgccagtccctgagctccca
gatttcttccagggcaagcacttctttctttacggggagttccctggggacgagcggcgg
aaactcatccgatacgtcacagccttcaatggggagctcgaggactatatgagtgaccgg
gttcagtttgtgatcacagcacaggaatgggatcccagctttgaggaggccctgatggac
aacccctccctggcattcgttcgtccccgatggatctacagttgcaatgagaagcagaag
ttacttcctcaccagctctatggggtggtgccgcaagcctga

DBGET integrated database retrieval system