KEGG   Homo sapiens (human): 7515Help
Entry
7515              CDS       T01001                                 

Gene name
XRCC1, RCC, SCAR26
Definition
(RefSeq) X-ray repair cross complementing 1
  KO
K10803  DNA-repair protein XRCC1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03410  Base excision repair
Module
hsa_M00296  BER complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    7515 (XRCC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    7515 (XRCC1)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Short Patch-BER factors
     7515 (XRCC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: XRCC1_N BRCT BRCT_2 PTCB-BRCT LIG3_BRCT
Motif
Other DBs
NCBI-GeneID: 7515
NCBI-ProteinID: NP_006288
OMIM: 194360
HGNC: 12828
Ensembl: ENSG00000073050
Vega: OTTHUMG00000182699
Pharos: P18887(Tbio)
UniProt: P18887 B2RCY5 Q59HH7
Structure
PDB: 

Position
19q13.31
AA seq 633 aa AA seqDB search
MPEIRLRHVVSCSSQDSTHCAENLLKADTYRKWRAAKAGEKTISVVLQLEKEEQIHSVDI
GNDGSAFVEVLVGSSAGGAGEQDYEVLLVTSSFMSPSESRSGSNPNRVRMFGPDKLVRAA
AEKRWDRVKIVCSQPYSKDSPFGLSFVRFHSPPDKDEAEAPSQKVTVTKLGQFRVKEEDE
SANSLRPGALFFSRINKTSPVTASDPAGPSYAAATLQASSAASSASPVSRAIGSTSKPQE
SPKGKRKLDLNQEEKKTPSKPPAQLSPSVPKRPKLPAPTRTPATAPVPARAQGAVTGKPR
GEGTEPRRPRAGPEELGKILQGVVVVLSGFQNPFRSELRDKALELGAKYRPDWTRDSTHL
ICAFANTPKYSQVLGLGGRIVRKEWVLDCHRMRRRLPSQRYLMAGPGSSSEEDEASHSGG
SGDEAPKLPQKQPQTKTKPTQAAGPSSPQKPPTPEETKAASPVLQEDIDIEGVQSEGQDN
GAEDSGDTEDELRRVAEQKEHRLPPGQEENGEDPYAGSTDENTDSEEHQEPPDLPVPELP
DFFQGKHFFLYGEFPGDERRKLIRYVTAFNGELEDYMSDRVQFVITAQEWDPSFEEALMD
NPSLAFVRPRWIYSCNEKQKLLPHQLYGVVPQA
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgccggagatccgcctccgccatgtcgtgtcctgcagcagccaggactcgactcactgt
gcagaaaatcttctcaaggcagacacttaccgaaaatggcgggcagccaaggcaggcgag
aagaccatctctgtggtcctacagttggagaaggaggagcagatacacagtgtggacatt
gggaatgatggctcagctttcgtggaggtgctggtgggcagttcagctggaggcgctggg
gagcaagactatgaggtccttctggtcacctcatctttcatgtccccttccgagagccgc
agtggctcaaaccccaaccgcgttcgcatgtttgggcctgacaagctggtccgggcagcc
gccgagaagcgctgggaccgggtcaaaattgtttgcagccagccctacagcaaggactcc
ccctttggcttgagttttgtacggtttcatagccccccagacaaagatgaggcagaggcc
ccgtcccagaaggtgacagtgaccaagcttggccagttccgtgtgaaggaggaggatgag
agcgccaactctctgaggccgggggctctcttcttcagccggatcaacaagacatcccca
gtcacagccagcgacccagcaggacctagctatgcagctgctaccctccaggcttctagt
gctgcctcctcagcctctccagtctccagggccataggcagcacctccaagccccaggag
tctcccaaagggaagaggaagttggatttgaaccaagaagaaaagaagacccccagcaaa
ccaccagcccagctgtcgccatctgttcccaagagacctaaattgccagctccaactcgt
accccagccacagccccagtccctgcccgagcacagggggcagtgacaggcaaaccccga
ggagaaggcaccgagcccagacgaccccgagctggcccagaggagctggggaagatcctt
cagggtgtggtagtggtgctgagtggcttccagaaccccttccgctccgagctgcgagat
aaggccctagagcttggggccaagtatcggccagactggacccgggacagcacgcacctc
atctgtgcctttgccaacacccccaagtacagccaggtcctaggcctgggaggccgcatc
gtgcgtaaggagtgggtgctggactgtcaccgcatgcgtcggcggctgccctcccagagg
tacctcatggcagggccaggttccagcagtgaggaggatgaggcctctcacagcggtggc
agcggagatgaagcccccaagcttcctcagaagcaaccccagaccaaaaccaagcccact
caggcagctggacccagctcaccccagaagcccccaacccctgaagagaccaaagcagcc
tcaccagtgctccaggaagatatagacattgagggggtacagtcagaaggacaggacaat
ggggcggaagattctggggacacagaggatgagctgaggagggtggcagagcagaaggaa
cacagactgccccctggccaggaggagaatggggaagacccgtatgcaggctccacggat
gagaacacggacagtgaggaacaccaggagcctcctgatctgccagtccctgagctccca
gatttcttccagggcaagcacttctttctttacggggagttccctggggacgagcggcgg
aaactcatccgatacgtcacagccttcaatggggagctcgaggactatatgagtgaccgg
gttcagtttgtgatcacagcacaggaatgggatcccagctttgaggaggccctgatggac
aacccctccctggcattcgttcgtccccgatggatctacagttgcaatgagaagcagaag
ttacttcctcaccagctctatggggtggtgccgcaagcctga

DBGET integrated database retrieval system