KEGG   Homo sapiens (human): 7695
Entry
7695              CDS       T01001                                 

Gene name
ZNF136, pHZ-20
Definition
(RefSeq) zinc finger protein 136
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    7695 (ZNF136)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    7695 (ZNF136)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Other Cys2His2 zinc factors
    7695 (ZNF136)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2_4 zf-C2H2 zf-C2H2_6 KRAB zf-C2H2_jaz Zn-ribbon_8 Zn_ribbon_SprT zf-C2H2_11 DUF3268 Zn_Tnp_IS1595 DUF4428
Other DBs
NCBI-GeneID: 7695
NCBI-ProteinID: NP_003428
OMIM: 604078
HGNC: 12920
Ensembl: ENSG00000196646
Vega: OTTHUMG00000156429
Pharos: P52737(Tdark)
UniProt: P52737
Position
19p13.2
AA seq 540 aa
MDSVAFEDVDVNFTQEEWALLDPSQKNLYRDVMWETMRNLASIGKKWKDQNIKDHYKHRG
RNLRSHMLERLYQTKDGSQRGGIFSQFANQNLSKKIPGVKLCESIVYGEVSMGQSSLNRH
IKDHSGHEPKEYQEYGEKPDTRNQCWKPFSSHHSFRTHEIIHTGEKLYDCKECGKTFFSL
KRIRRHIITHSGYTPYKCKVCGKAFDYPSRFRTHERSHTGEKPYECQECGKAFTCITSVR
RHMIKHTGDGPYKCKVCGKPFHSLSSFQVHERIHTGEKPFKCKQCGKAFSCSPTLRIHER
THTGEKPYECKQCGKAFSYLPSLRLHERIHTGEKPFVCKQCGKAFRSASTFQIHERTHTG
EKPYECKECGEAFSCIPSMRRHMIKHTGEGPYKCKVCGKPFHSLSPFRIHERTHTGEKPY
VCKHCGKAFVSSTSIRIHERTHTGEKPYECKQCGKAFSYLNSFRTHEMIHTGEKPFECKR
CGKAFRSSSSFRLHERTHTGQKPYHCKECGKAYSCRASFQRHMLTHAEDGPPYKCMWESL
NT seq 1623 nt   +upstreamnt  +downstreamnt
atggactcggtggcttttgaggatgtagatgtgaacttcacccaggaggagtgggctttg
ctagatccttcccagaagaatctctacagagatgtgatgtgggaaaccatgaggaatctg
gcctctatagggaaaaaatggaaggaccagaacattaaagatcactacaaacaccgaggg
agaaatctaagaagtcatatgttagaaagactctatcaaactaaggatggtagtcagcgt
ggaggaatttttagccagtttgcaaatcagaatctgagcaagaaaatccctggagtgaaa
ctctgtgaaagcattgtatatggagaagtcagcatgggtcagtcatcccttaatagacac
atcaaagatcacagtggacatgaaccaaaggaatatcaggaatatggagagaagccagat
acacgtaaccagtgttggaaacccttcagttctcaccactcctttcgaacacatgagata
attcacactggagagaaactctatgattgtaaggaatgtggaaaaaccttcttttctctc
aaaagaattagaagacacatcatcacacacagtggatatacaccatataaatgtaaggtg
tgtgggaaagcttttgattatcccagtagatttcgaacacatgaaagaagtcacactgga
gagaaaccctatgaatgtcaggaatgtggaaaagccttcacttgtatcacaagtgttcga
agacacatgataaagcacactggagatggaccttataaatgtaaggtatgtgggaaaccc
tttcattctctgagttcatttcaagtgcatgaaagaattcacactggagaaaaacccttt
aaatgtaagcaatgtggtaaagccttcagttgttccccaaccttacgaatacatgaaaga
acccatactggagagaaaccttatgaatgcaagcagtgtgggaaggccttcagttatctc
ccctcccttcgactacatgaaagaattcacactggtgagaaacccttcgtatgtaaacaa
tgtggtaaagcctttagatctgccagtacctttcaaatacatgaaaggactcacactgga
gaaaaaccttatgaatgtaaggaatgtggggaagcattcagttgtatcccaagtatgcga
agacacatgataaaacatactggagaaggaccttataaatgtaaggtatgtgggaaaccc
tttcattctctgagtccatttcgaatacatgaaagaactcacactggagagaaaccttat
gtatgtaaacattgtggtaaagctttcgtttcttcaacatcaattcgaatacatgaaaga
actcatactggagagaaaccctatgagtgtaagcaatgtgggaaagccttcagttatctc
aactcctttcgaacacatgaaatgattcacactggtgagaaaccctttgaatgtaagcga
tgtggtaaagcctttagatcttctagttcctttcgactacatgaaaggactcacactgga
cagaaaccctatcattgcaaggaatgtgggaaagcctattcttgccgtgccagctttcag
agacacatgttaacacatgctgaagatggaccaccttataaatgcatgtgggaaagcctt
taa

DBGET integrated database retrieval system