KEGG   Homo sapiens (human): 7741
Entry
7741              CDS       T01001                                 
Symbol
ZSCAN26, SRE-ZBP, SREZBP, ZNF187
Name
(RefSeq) zinc finger and SCAN domain containing 26
  KO
K09230  SCAN domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    7741 (ZSCAN26)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    7741 (ZSCAN26)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 SCAN zf-C2H2_4 XPA_N Zn-ribbon_8 zf-C2H2_6 zf-C2H2_11 zf_UBZ zf-C2H2_jaz HVO_2753_ZBP
Other DBs
NCBI-GeneID: 7741
NCBI-ProteinID: NP_001104509
OMIM: 616474
HGNC: 12978
Ensembl: ENSG00000197062
UniProt: Q16670 B4DVH3 B3KTR1
Position
6:28267143..28278204
AA seq 478 aa
MATALVSAHSLAPLNLKKEGLRVVREDHYSTWEQGFKLQGNSKGLGQEPLCKQFRQLRYE
ETTGPREALSRLRELCQQWLQPETHTKEQILELLVLEQFLIILPKELQARVQEHHPESRE
DVVVVLEDLQLDLGETGQQDPDQPKKQKILVEEMAPLKGVQEQQVRHECEVTKPEKEKGE
ETRIENGKLIVVTDSCGRVESSGKISEPMEAHNEGSNLERHQAKPKEKIEYKCSEREQRF
IQHLDLIEHASTHTGKKLCESDVCQSSSLTGHKKVLSREKGHQCHECGKAFQRSSHLVRH
QKIHLGEKPYQCNECGKVFSQNAGLLEHLRIHTGEKPYLCIHCGKNFRRSSHLNRHQRIH
SQEEPCECKECGKTFSQALLLTHHQRIHSHSKSHQCNECGKAFSLTSDLIRHHRIHTGEK
PFKCNICQKAFRLNSHLAQHVRIHNEEKPYQCSECGEAFRQRSGLFQHQRYHHKDKLA
NT seq 1437 nt   +upstreamnt  +downstreamnt
atggcaacagcattggtgagtgcccattccctggctcccctgaatctgaagaaggagggg
cttcgggtagtgagggaggatcactactctacttgggaacagggattcaagctgcaagga
aacagtaaaggccttggacaggagccattgtgcaaacaattcaggcagttgcgttatgaa
gagaccacaggacctcgagaagcactaagtcggctccgggagctctgtcaacagtggcta
cagcccgagacccataccaaggagcagatcctggagctgctggtgctggagcagtttctg
atcatcctgcctaaggagctccaggcccgggtgcaggagcatcacccagagagcagggag
gacgtggttgttgttctggaggatttgcagctggatcttggagaaacaggacaacaggac
ccagaccagccaaagaaacaaaaaatacttgtggaggagatggcccctctgaaaggagta
caggaacagcaggttcggcatgagtgtgaagttacaaagcctgagaaagagaagggtgag
gagacaaggattgagaatgggaagcttattgtagtaacagactcttgtggaagagtagag
tcatctgggaaaatatctgaacccatggaggctcataatgagggctctaacttggaaagg
catcaggccaagcccaaagagaagattgagtataaatgctcagaacgtgagcagagattc
atccagcacttggacctgattgaacatgcgagtacacacacgggaaagaaactctgcgag
tctgatgtgtgtcagagttccagtcttacaggacataagaaagtcctctctagagagaaa
ggtcatcagtgtcatgagtgtgggaaagcctttcagaggagttcacacctcgtcagacat
cagaaaatccatcttggtgagaagccttatcagtgcaatgagtgtggcaaagtctttagc
cagaatgcaggccttttggaacatctcagaattcatactggagagaaaccttatctatgt
atccattgtggaaaaaattttaggcgcagctctcaccttaatcgacatcagagaattcac
agtcaggaggagccctgtgagtgcaaggagtgtggaaaaacctttagtcaggccttactc
ctcacccaccatcagagaatccatagtcactccaaaagccatcaatgtaacgagtgtgga
aaagctttcagtttgacctcagaccttattcgacaccacagaattcatactggagaaaaa
cctttcaagtgtaacatatgccagaaagccttccgactaaactcacaccttgctcagcat
gtaagaatccacaatgaagaaaaaccctatcagtgtagtgaatgtggagaagccttcagg
caaaggtcaggtctttttcaacatcagagatatcaccacaaagacaaactggcttga

DBGET integrated database retrieval system