KEGG   Homo sapiens (human): 79075
Entry
79075             CDS       T01001                                 

Gene name
DSCC1, DCC1
Definition
(RefSeq) DNA replication and sister chromatid cohesion 1
  KO
K11271  sister chromatid cohesion protein DCC1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    79075 (DSCC1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   CTF18-RFC complex
    79075 (DSCC1)
SSDB
Motif
Pfam: Dcc1 DUF4763 Med9
Other DBs
NCBI-GeneID: 79075
NCBI-ProteinID: NP_076999
OMIM: 613203
HGNC: 24453
Ensembl: ENSG00000136982
Vega: OTTHUMG00000165010
Pharos: Q9BVC3(Tbio)
UniProt: Q9BVC3
Position
8q24.12
AA seq 393 aa
MKRTRDEVDATLQIAKLNAAELLPAVHCLGFGPGASGAAAGDFCLLELEPTLCQQLEDGH
SLVIRGDKDEQAVLCSKDKTYDLKIADTSNMLLFIPGCKTPDQLKKEDSHCNIIHTEIFG
FSNNYWELRRRRPKLKKLKKLLMENPYEGPDSQKEKDSNSSKYTTEDLLDQIQASEEEIM
TQLQVLNACKIGGYWRILEFDYEMKLLNHVTQLVDSESWSFGKVPLNTCLQELGPLEPEE
MIEHCLKCYGKKYVDEGEVYFELDADKICRAAARMLLQNAVKFNLAEFQEVWQQSVPEGM
VTSLDQLKGLALVDRHSRPEIIFLLKVDDLPEDNQERFNSLFSLREKWTEEDIAPYIQDL
CGEKQTIGALLTKYSHSSMQNGVKVYNSRRPIS
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgaagaggacccgcgacgaggtggatgcgacgctgcagatcgccaagctgaatgcggcc
gagctgctgccggcggtgcactgcctgggcttcggccctggggccagcggcgctgcagcc
ggcgacttctgcctgctggagctggagcccacgctgtgccagcagctggaggatggacac
agtcttgtgattcgtggtgataaagacgagcaagctgtgctgtgcagtaaagacaaaaca
tacgacttgaagatagcagacacttccaatatgttgcttttcattcctggttgtaaaact
ccggaccagttgaagaaggaagattcacactgtaacattattcacactgagatctttggt
ttttctaataattattgggaattaagaagacgtagacccaagttaaagaagctaaagaaa
cttttgatggaaaatccatatgaaggacctgacagtcaaaaagagaaggattcaaatagc
tcaaaatatacaactgaagatttgcttgatcaaattcaggcaagtgaggaagaaataatg
acccaattacaagttctaaatgcctgtaagattggaggttattggaggattcttgaattt
gattatgagatgaaacttctgaatcatgtaactcagcttgtggattctgaatcatggtct
tttggtaaagttcctttgaacacatgccttcaggaactcggaccattggagccagaggaa
atgatagaacactgtcttaaatgttatgggaagaaatatgtagatgaaggcgaagtttat
tttgagttggatgctgataaaatatgtagagcagcagcacgaatgctacttcagaatgcg
gtgaaattcaatctcgctgagtttcaagaagtgtggcagcagagtgttcctgaaggaatg
gtaactagtcttgatcagcttaagggtttagcgctggtggatagacactcgagaccagaa
atcatatttttgctgaaagtagatgatttacctgaggataatcaggaacgttttaatagc
cttttctctctaagggagaagtggacagaagaagatattgctccatatattcaagatttg
tgtggagagaagcaaaccataggtgcattactcactaaatattctcattcttcgatgcaa
aatggtgttaaagtttataattcgagaagacccatttcttaa

DBGET integrated database retrieval system