KEGG   Homo sapiens (human): 79077Help
Entry
79077             CDS       T01001                                 

Gene name
DCTPP1, CDA03, RS21C6, XTP3TPA
Definition
(RefSeq) dCTP pyrophosphatase 1
  KO
K16904  dCTP diphosphatase [EC:3.6.1.12]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00240  Pyrimidine metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    79077 (DCTPP1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.12  dCTP diphosphatase
     79077 (DCTPP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MazG-like MazG dUTPase_2
Motif
Other DBs
NCBI-GeneID: 79077
NCBI-ProteinID: NP_077001
OMIM: 615840
HGNC: 28777
Ensembl: ENSG00000179958
Vega: OTTHUMG00000132416
Pharos: Q9H773(Tbio)
UniProt: Q9H773
Position
16p11.2
AA seq 170 aa AA seqDB search
MSVAGGEIRGDTGGEDTAAPGRFSFSPEPTLEDIRRLHAEFAAERDWEQFHQPRNLLLAL
VGEVGELAELFQWKTDGEPGPQGWSPRERAALQEELSDVLIYLVALAARCRVDLPLAVLS
KMDINRRRYPAHLARSSSRKYTELPHGAISEDQAVGPADIPCDSTGQTST
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtggccggtggggagattcgtggggacacggggggagaggacactgctgctccc
ggccggttcagcttcagcccggagcccacgctcgaggacatccgccgcctccatgctgag
tttgctgcggaacgagactgggaacagttccatcagcctcggaatctcctcctggccttg
gttggggaagtgggggagctggcagaactctttcagtggaaaaccgatggggaacctggc
ccccaaggctggtcccccagggaacgggcagcccttcaagaggagcttagtgacgtcctc
atctacctggtggcattagcagcccgctgccgtgtggatctgccgctagcagtgctctcc
aaaatggacatcaaccggcgacgctacccagcccatctggcccgcagctcttcccgcaag
tatacagaattgccccatggggccatctctgaagaccaggctgtggggcctgcggacatt
ccctgtgactccacaggccagacctcaacctag

DBGET integrated database retrieval system