KEGG   Homo sapiens (human): 79596Help
Entry
79596             CDS       T01001                                 

Gene name
OBI1, C13orf7, RNF219
Definition
(RefSeq) ORC ubiquitin ligase 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C3HC4_2 zf-RING_2 zf-C3HC4_3 zf-C3HC4 CENP-Q zf-rbx1 bZIP_1 zf-P11 zf-RING_UBOX TMF_TATA_bd DivIC TMF_DNA_bd SseC NPV_P10 zf-RING_6 PEP-utilisers_N ZapB
Motif
Other DBs
NCBI-GeneID: 79596
NCBI-ProteinID: NP_078822
OMIM: 615906
HGNC: 20308
Ensembl: ENSG00000152193
Vega: OTTHUMG00000017122
Pharos: Q5W0B1(Tdark)
UniProt: Q5W0B1
Position
13q31.1
AA seq 726 aa AA seqDB search
MAQTVQNVTLSLTLPITCHICLGKVRQPVICINNHVFCSICIDLWLKNNSQCPACRVPIT
PENPCKEIIGGTSESEPMLSHTVRKHLRKTRLELLHKEYEDEIDCLQKEVEELKSKNLSL
ESQIKTILDPLTLVQGNQNEDKHLVTDNPSKINPETVAEWKKKLRTANEIYEKVKDDVDK
LKEANKKLKLENGGLVRENLRLKAEVDNRSPQKFGRFAVAALQSKVEQYERETNRLKKAL
ERSDKYIEELESQVAQLKNSSEEKEAMNSICQTALSADGKGSKGSEEDVVSKNQGDSARK
QPGSSTSSSSHLAKPSSSRLCDTSSARQESTSKADLNCSKNKDLYQEQVEVMLDVTDTSM
DTYLEREWGNKPSDCVPYKDEELYDLPAPCTPLSLSCLQLSTPENRESSVVQAGGSKKHS
NHLRKLVFDDFCDSSNVSNKDSSEDDISRSENEKKSECFSSPKTGFWDCCSTSYAQNLDF
ESSEGNTIANSVGEISSKLSEKSGLCLSKRLNSIRSFEMNRTRTSSEASMDAAYLDKISE
LDSMMSESDNSKSPCNNGFKSLDLDGLSKSSQGSEFLEEPDKLEEKTELNLSKGSLTNDQ
LENGSEWKPTSFFLLSPSDQEMNEDFSLHSSSCPVTNEIKPPSCLFQTEFSQGILLSSSH
RLFEDQRFGSSLFKMSSEMHSLHNHLQSPWSTSFVPEKRNKNVNQSTKRKIQSSLSSASP
SKATKS
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atggctcagaccgtgcagaatgttacattgtcgctcactctgcccatcacgtgccacatt
tgcttggggaaggtacgtcagcctgtcatatgcatcaacaaccatgtattttgttcgatt
tgtattgatttgtggttgaagaataatagccagtgtccagcttgcagagtccccatcact
cctgaaaatccttgcaaagaaattataggaggaacaagtgaaagtgaacctatgctaagc
catacggtcaggaagcatcttcggaaaactagacttgaattactacacaaagaatatgag
gacgaaatagattgtttacagaaagaagtagaagagcttaagagtaaaaatctcagcttg
gagtcacagatcaaaactattctggatcctttaaccttggtgcagggcaaccaaaatgaa
gacaaacatctagtcacagataatccaagtaaaattaacccagaaactgtagcagagtgg
aagaaaaaactcagaacagctaatgaaatctatgaaaaagtgaaagatgatgtggataag
ctaaaggaggcaaataaaaaattgaaattggaaaatggtggtctggtgagggagaattta
cgactgaaggctgaagttgataacagatcacctcaaaagtttggaaggtttgcagttgct
gctcttcagtccaaagtagaacagtatgagcgtgaaaccaatcgcctcaagaaagccctg
gaacgaagtgataagtatatagaggaactagaatctcaagttgcacagctaaaaaattca
agtgaagagaaagaagctatgaattccatttgccagacagcactttctgcagatggcaaa
gggagcaaaggcagtgaggaggatgtggtgtcaaagaatcaaggcgatagtgccagaaag
cagcctggctcatccacctccagttcttctcacctagcgaagccttccagcagcagactg
tgtgacaccagttctgcaaggcaggaaagtaccagcaaagcagaccttaactgttctaag
aacaaagacctatatcaagaacaggtagaagtaatgttagatgtgacagatacaagtatg
gatacttatttggaaagagaatgggggaataaaccaagtgactgtgtaccctacaaagat
gaagaactttatgatcttccagctccttgtactcctttgtcccttagttgccttcagctc
agtactccagaaaatagagagagctctgtggtccaagcaggaggttccaaaaagcactca
aaccatctcagaaaattggtgtttgatgatttttgtgattcttcaaatgtttctaataaa
gattcttcagaagatgatataagtagaagtgaaaatgaaaagaaatcagaatgtttttct
tccccaaagacaggattttgggactgttgttccacaagctatgcccaaaacttagatttt
gaaagttcagaggggaacacgatagcaaattctgttggagaaatatcttcaaaattgagt
gagaaatcaggcttatgtttatccaaaaggttgaattctattcgctcttttgaaatgaac
cggacaagaacatccagtgaagcatcgatggatgctgcttaccttgacaaaatctctgag
ttggattcaatgatgtcagagtcagacaacagcaagagcccttgtaataacggttttaag
tcactggatttggatgggttatcaaagtcatctcaaggcagtgaatttcttgaggaacct
gataagttggaagaaaaaactgagctaaacctttccaaaggttctctaactaatgatcag
ttagaaaatggaagtgaatggaaacccacttctttttttctcctctctccatctgaccaa
gaaatgaatgaagatttttcactccattccagttcttgtccagtaactaatgaaatcaaa
cccccaagctgcttgtttcagacagagttttcccagggcattttgttaagcagttcacat
cgactatttgaagatcaaagatttgggtcatctttgtttaagatgtcctcagagatgcac
agtcttcataaccaccttcagtctccttggtctacttcctttgtgcctgaaaagaggaat
aaaaatgtgaatcaatcaacaaaaagaaaaatccagagcagcctttccagtgccagccca
tcaaaagcaactaaaagttga

DBGET integrated database retrieval system