KEGG   Homo sapiens (human): 79618
Entry
79618             CDS       T01001                                 
Symbol
HMBOX1, HNF1LA, HOT1, PBHNF, TAH1
Name
(RefSeq) homeobox containing 1
  KO
K24885  homeobox-containing protein 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    79618 (HMBOX1)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain POU
    79618 (HMBOX1)
SSDB
Motif
Pfam: HNF-1_N Homeodomain Homeobox_KN HTH_37 HTH_3 AbiJ_NTD3 HTH_24 DUF494 HTH_31 CUT NOC3p HTH_23
Other DBs
NCBI-GeneID: 79618
NCBI-ProteinID: NP_001129198
OMIM: 618610
HGNC: 26137
Ensembl: ENSG00000147421
Pharos: Q6NT76(Tbio)
UniProt: Q6NT76
Structure
Position
8:28890116..29053270
AA seq 420 aa
MLSSFPVVLLETMSHYTDEPRFTIEQIDLLQRLRRTGMTKHEILHALETLDRLDQEHSDK
FGRRSSYGGSSYGNSTNNVPASSSTATASTQTQHSGMSPSPSNSYDTSPQPCTTNQNGRE
NNERLSTSNGKMSPTRYHANSMGQRSYSFEASEEDLDVDDKVEELMRRDSSVIKEEIKAF
LANRRISQAVVAQVTGISQSRISHWLLQQGSDLSEQKKRAFYRWYQLEKTNPGATLSMRP
APIPIEDPEWRQTPPPVSATSGTFRLRRGSRFTWRKECLAVMESYFNENQYPDEAKREEI
ANACNAVIQKPGKKLSDLERVTSLKVYNWFANRRKEIKRRANIEAAILESHGIDVQSPGG
HSNSDDVDGNDYSEQDDSTSHSDHQDPISLAVEMAAVNHTILALARQGANEIKTEALDDD
NT seq 1263 nt   +upstreamnt  +downstreamnt
atgcttagttcctttccagtggttttgctggaaaccatgtctcattatacagatgaaccc
agatttaccatagagcagatagatctgcttcagcgacttcggcgtactggaatgactaaa
catgaaattctccatgccttggaaactttggaccgtcttgatcaagagcatagtgacaag
tttggaagaaggtccagctatggaggaagttcatatgggaatagtactaacaatgtccca
gcatcttcctctacagctacagcttccacacagacgcagcattcgggaatgtccccgtca
cctagcaacagttatgatacttccccacagccttgcactaccaatcaaaatgggagggag
aataatgagcgattatctacatccaatggaaagatgtcaccaactcgctaccatgcaaac
agcatgggtcagaggtcatacagttttgaagcctcagaagaggacctagatgtagatgat
aaagtggaagaattaatgaggagggacagcagtgtgataaaagaggaaatcaaagccttt
cttgccaatcggaggatttcccaagcagttgttgcacaggtaacaggtatcagtcagagc
cggatctctcattggctgttgcagcagggatcagacctgagtgaacagaagaaaagagca
ttttaccgatggtatcaacttgagaagacaaaccctggcgctacactaagtatgagacca
gcccccattccaatagaggaccctgaatggagacaaacgcctcccccagtctctgccaca
tctggtactttccgactgcgacgagggagtcgatttacctggagaaaggagtgcctggct
gttatggaaagttacttcaatgagaatcaatacccagatgaagcaaagagggaagaaatt
gcaaacgcttgcaatgcagttatacagaagccaggcaaaaagctgtcagatctggaaaga
gttacctccctgaaagtatataattggtttgctaacagaaggaaggagatcaagaggaga
gccaatattgaagcagcaatcctggagagtcatgggatagatgtgcagagtccaggaggc
cactcaaacagtgatgatgtcgacgggaatgactactctgagcaggatgacagtacgagc
catagtgaccaccaagaccccatctcattagctgtggaaatggcagcagtcaaccacact
atcttggcattggcccgacaaggagccaacgaaatcaagacagaggccctggatgatgac
tga

DBGET integrated database retrieval system