KEGG   Homo sapiens (human): 79673
Entry
79673             CDS       T01001                                 
Symbol
ZNF329
Name
(RefSeq) zinc finger protein 329
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 zf-C2H2_jaz Zn-ribbon_8 zf_UBZ XPA_N Zn_ribbon_SprT HypA LIM zf-C2HE YuA_Gp49 HVO_2753_ZBP zf-C2HC_2 Fer4_9
Other DBs
NCBI-GeneID: 79673
NCBI-ProteinID: NP_078896
HGNC: 14209
Ensembl: ENSG00000181894
UniProt: Q86UD4
Position
19:complement(58126248..58155104)
AA seq 541 aa
MRLKMTTRNFPEREVPCDVEVERFTREVPCLSSLGDGWDCENQEGHLRQSALTLEKPGTQ
EAICEYPGFGEHLIASSDLPPSQRVLATNGFHAPDSNVSGLDCDPALPSYPKSYADKRTG
DSDACGKGFNHSMEVIHGRNPVREKPYKYPESVKSFNHFTSLGHQKIMKRGKKSYEGKNF
ENIFTLSSSLNENQRNLPGEKQYRCTECGKCFKRNSSLVLHHRTHTGEKPYTCNECGKSF
SKNYNLIVHQRIHTGEKPYECSKCGKAFSDGSALTQHQRIHTGEKPYECLECGKTFNRNS
SLILHQRTHTGEKPYRCNECGKPFTDISHLTVHLRIHTGEKPYECSKCGKAFRDGSYLTQ
HERTHTGEKPFECAECGKSFNRNSHLIVHQKIHSGEKPYECKECGKTFIESAYLIRHQRI
HTGEKPYGCNQCQKLFRNIAGLIRHQRTHTGEKPYECNQCGKAFRDSSCLTKHQRIHTKE
TPYQCPECGKSFKQNSHLAVHQRLHSREGPSRCPQCGKMFQKSSSLVRHQRAHLGEQPME
T
NT seq 1626 nt   +upstreamnt  +downstreamnt
atgagattgaaaatgacgactcggaattttcctgagagagaagtaccctgtgatgtagaa
gtggaaagattcacaagggaagttccctgcttgtccagtttaggtgatggttgggactgt
gagaaccaggagggacacttgaggcaatcagctttaactctggagaaaccagggactcag
gaagcaatttgtgaatatcctggttttggggagcatttgattgcaagctcagaccttcca
ccgtctcagagagttctggcaacaaatggtttccatgcacctgactcaaatgttagtggt
ctggattgtgaccccgccttacccagctatcctaaaagttatgcagataagagaactggt
gacagtgatgcctgtggaaaaggcttcaaccattccatggaagttattcatggaagaaat
ccagtgagagagaagccctacaaataccctgaaagtgttaagtcttttaatcattttacc
tctcttggtcatcagaaaataatgaaaagaggcaagaaatcgtatgaaggtaagaatttt
gagaacatctttactctgagctcatcgcttaatgaaaaccagagaaatctccctggagag
aaacaatatagatgtactgaatgtggcaaatgcttcaaacggaactcttctcttgttttg
catcaccgaactcacaccggagagaagccttatacttgtaatgagtgtggaaagtccttc
tccaagaactacaacctgattgtgcatcaaagaatccacacaggagagaagccctatgaa
tgcagtaaatgtgggaaagctttcagtgatggctcagctctgacacagcaccagagaatt
cacacaggcgagaaaccttatgaatgcctagagtgtggaaaaaccttcaaccgaaattca
tccttaattttgcaccaaagaactcatacaggggaaaaaccatatagatgtaacgaatgt
gggaaacccttcactgacatctcccaccttacagtgcatctcagaatccacaccggtgag
aagccctatgagtgtagcaaatgtggaaaggctttccgggacggctcgtacctcacccag
catgagaggactcacactggagaaaagccctttgagtgtgcagagtgcgggaaatccttc
aacagaaactctcacctcattgtgcatcaaaagatccattctggggagaaaccctatgaa
tgtaaagaatgtggcaagactttcatcgagagtgcgtacctcatcaggcatcagaggatt
catactggcgagaagccctatggctgcaaccagtgtcagaaacttttcaggaatatcgct
ggcctcattaggcaccagaggactcatactggtgagaagccctatgagtgtaatcagtgt
ggcaaagccttcagggacagctcctgtctgaccaagcaccagagaattcacactaaggag
accccatatcagtgtccagaatgtgggaagtccttcaagcagaactctcacctggcagta
catcagagactccatagcagggagggtcccagccggtgtcctcagtgtggaaaaatgttc
caaaagagctcatcccttgttcgacatcaaagagcacacctgggagagcaacccatggaa
acataa

DBGET integrated database retrieval system