KEGG   Homo sapiens (human): 79894Help
Entry
79894             CDS       T01001                                 

Gene name
ZNF672
Definition
(RefSeq) zinc finger protein 672
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_jaz zf-C2H2_6 zf-C2H2_11 Zn-ribbon_8 DUF3268 zinc_ribbon_9 zf-met zinc_ribbon_15 zf-AN1
Motif
Other DBs
NCBI-GeneID: 79894
NCBI-ProteinID: NP_079112
HGNC: 26179
Ensembl: ENSG00000171161
Vega: OTTHUMG00000040377
Pharos: Q499Z4(Tdark)
UniProt: Q499Z4
Position
1q44
AA seq 452 aa AA seqDB search
MFATSGAVAAGKPYSCSECGKSFCYSSVLLRHERAHGGDGRFRCLECGERCARAADLRAH
RRTHAGQTLYICSECGQSFRHSGRLDLHLGAHRQRCRTCPCRTCGRRFPHLPALLLHRRR
QHLPERPRRCPLCARTFRQSALLFHQARAHPLGTTSDPAAPPHRCAQCPRAFRSGAGLRS
HARIHVSRSPTRPRVSDAHQCGVCGKCFGKSSTLTRHLQTHSGEKPFKCPECGKGFLESA
TLVRHQRTHTGEKPYACGDCGRCFSESSTLLRHRRSHQGERPHACATCGKGFGQRSDLVV
HQRIHTGEKPFACPECGRRFSDRSDLTKHRRTHTGEKPYRCELCGKRFTCVSNLNVHRRN
HAGHKPHKCPECSKAFSVASKLALHRKTHLGERPAECAECGKCFSHSRSLSQHQRAHTRA
RTAAAVAIQSAVGTALVFEGPAEQEKPGFSVS
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgtttgccacatctggggcagtggcagcggggaagccttactcgtgcagcgaatgtggc
aagagcttctgctacagctcagtgctgctgcgacatgaacgagctcacggcggtgacggc
cgcttccgttgcctagaatgcggtgagcgctgtgcacgggctgctgacctccgagcgcac
aggcgcacgcatgctggccagaccctctacatctgcagtgagtgcggacaaagcttccgc
cacagcggccgtcttgacctacacttgggcgcacaccggcagcgatgccgcacttgcccc
tgccgcacatgcggccggcgcttcccgcacctcccggcgctgctgctacaccggcgccgc
cagcatctgccagagcggccccgccgctgcccgctgtgcgcccgcaccttccggcagagc
gcgctgctcttccaccaggcgcgggcgcaccccttggggacaacctctgaccctgctgcc
ccaccccaccgctgcgcgcagtgcccgcgagccttccgaagcggcgccgggctgcggagt
cacgcgcgcatccacgtgtcccggagccccacgcgaccccgtgtctcagacgcccaccag
tgtggcgtgtgcggcaagtgctttggcaagagctctacgctgacgcgacacctgcagacg
cactcgggggagaaacccttcaagtgcccggagtgcggcaagggcttcctggagagcgcc
acgctggtgcgccaccagcgcacacacacgggcgagaagccgtacgcatgtggcgactgt
ggacgctgcttcagcgagagttccacgctgctgcgccatcggcgcagccatcagggcgag
cggccacatgcgtgcgccacttgcggcaagggtttcgggcagcgctccgacctggtggtg
caccagcgcatccacacgggcgagaagcccttcgcgtgccccgagtgcggccgccgcttc
agcgaccgctcggacctcaccaagcaccggcgcacgcacacgggcgagaagccctaccgc
tgcgaactgtgcggcaagcggttcacgtgcgtgtccaatctcaacgtgcatcggcgcaac
catgccggccacaagccacacaaatgccccgagtgcagcaaggccttcagcgtcgcctcc
aagcttgcactgcaccgcaagacgcacctgggcgaacggccagcggagtgcgcagagtgc
ggcaagtgcttcagccacagccgctcgctgtcacagcatcagcgggcccacacgcgcgcc
cgcaccgctgccgccgttgccatccagtccgcagtgggcactgccctcgtctttgagggg
ccggctgaacaggaaaagccagggttctctgtgtcctag

DBGET integrated database retrieval system