KEGG   Homo sapiens (human): 79943Help
Entry
79943             CDS       T01001                                 

Gene name
ZNF696
Definition
(RefSeq) zinc finger protein 696
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 Zn-ribbon_8 XPA_N zinc_ribbon_15 ADK_lid zf-C2H2_11 C1_4 OSTMP1
Motif
Other DBs
NCBI-GeneID: 79943
NCBI-ProteinID: NP_112157
HGNC: 25872
Ensembl: ENSG00000185730
Vega: OTTHUMG00000164957
Pharos: Q9H7X3(Tdark)
UniProt: Q9H7X3
Position
8q24.3
AA seq 374 aa AA seqDB search
MEPGGEPTGAKESSTLMESLAAVKAAFLAQAPSGSRSAEVQAAQSTEPAAEAGAPEGEGH
RGGPPRALGSLGLCENQEARERPGGSPRGPVTSEKTGGQSGLESDVPPNAGPGAEGGGSW
KGRPFPCGACGRSFKCSSDAAKHRSIHSGEKPYECSDCGKAFIHSSHVVRHQRAHSGERP
YACAECGKAFGQSFNLLRHQRVHTGEKPYACADCGKAFGQRSDAAKHRRTHTGERLYACG
ECGKRFLHSSNVVRHRRTHHGENPYECRECGQAFSQSSNLLQHQRVHTGERPFACQDCGR
AFSRSSFLREHRRIHTGEKPHQCGHCGRAFRALSGFFRHQRLHTGEKPFRCTECGRAFRL
SFHLIQHRRVHGAE
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atggagccaggaggagagcccacaggtgctaaagagagcagtaccctgatggagtccctt
gcagctgtgaaggctgctttcctggcgcaggccccgagtggcagccggtcagccgaggtg
caggcagctcagagcacggagcctgccgcagaggcaggcgctcccgagggagagggccac
agaggggggcctccccgggcgttggggtctcttggcctttgtgaaaaccaggaagccaga
gagaggcccggaggttcccctcgaggcccggtcacttctgagaaaactggaggacagagt
ggcctcgagtcagacgtccctccgaacgcaggccccggcgcagagggcgggggcagctgg
aaggggcggcctttcccgtgcggcgcctgtggccgcagcttcaagtgctcctcggacgcg
gcaaagcaccggagcatccactcgggggagaaaccgtacgagtgcagcgactgcgggaag
gccttcatccacagctcgcacgtggtccggcaccagcgggcgcacagcggggagaggccc
tacgcgtgcgccgagtgcggcaaggccttcggccagagcttcaacctcctccggcaccag
cgcgtgcacacgggcgagaagccctacgcgtgcgccgactgcggcaaggccttcggccag
aggtcggacgccgccaagcaccgccgcacccacaccggggagaggctgtacgcgtgcggc
gagtgcgggaagcgcttcctgcacagctcgaacgtggtccggcaccggcggacccaccac
ggggagaacccgtacgagtgccgggagtgcggccaggccttcagccagagctccaacctc
ctccagcaccagcgcgtgcacacgggggagcggcccttcgcctgccaggactgcggccgc
gccttcagccgcagctccttcctccgcgagcaccgccgcatccacaccggggagaagccc
caccagtgcggccactgcgggcgcgcgttccgggcgctgtcgggcttcttccggcaccag
cgactccacacgggcgagaagccgttccgctgcaccgagtgcggccgcgccttccgcctg
agcttccacctcatccagcaccggcgggtgcatggcgccgagtga

DBGET integrated database retrieval system