KEGG   Homo sapiens (human): 80014
Entry
80014             CDS       T01001                                 

Gene name
WWC2, BOMB
Definition
(RefSeq) WW and C2 domain containing 2
Organism
hsa  Homo sapiens (human)
Motif
Pfam: WW Phage_Nu1
Other DBs
NCBI-GeneID: 80014
NCBI-ProteinID: NP_079225
HGNC: 24148
Ensembl: ENSG00000151718
Vega: OTTHUMG00000150685
Pharos: Q6AWC2(Tbio)
UniProt: Q6AWC2
Position
4q35.1
AA seq 1192 aa
MPRRAGSGQLPLPRGWEEARDYDGKVFYIDHNTRRTSWIDPRDRLTKPLSFADCVGDELP
WGWEAGFDPQIGVYYIDHINKTTQIEDPRKQWRGEQEKMLKDYLSVAQDALRTQKELYHV
KEQRLALALDEYVRLNDAYKEKSSSHTSLFSGSSSSTKYDPDILKAEISTTRLRVKKLKR
ELSQMKQELLYKEQGFETLQQIDKKMSGGQSGYELSEAKAILTELKSIRKAISSGEKEKQ
DLMQSLAKLQERFHLDQNIGRSEPDLRCSPVNSHLCLSRQTLDAGSQTSISGDIGVRSRS
NLAEKVRLSLQYEEAKRSMANLKIELSKLDSEAWPGALDIEKEKLMLINEKEELLKELQF
VTPQKRTQDELERLEAERQRLEEELLSVRGTPSRALAERLRLEERRKELLQKLEETTKLT
TYLHSQLKSLSASTLSMSSGSSLGSLASSRGSLNTSSRGSLNSLSSTELYYSSQSDQIDV
DYQYKLDFLLQEKSGYIPSGPITTIHENEVVKSPSQPGQSGLCGVAAAATGHTPPLAEAP
KSVASLSSRSSLSSLSPPGSPLVLEGTFPMSSSHDASLHQFTADFEDCELSSHFADISLI
ENQILLDSDSGGASQSLSEDKDLNECAREPLYEGTADVEKSLPKRRVIHLLGEKTTCVSA
AVSDESVAGDSGVYEAFVKQPSEMEDVTYSEEDVAIVETAQVQIGLRYNAKSSSFMVIIA
QLRNLHAFLIPHTSKVYFRVAVLPSSTDVSCLFRTKVHPPTESILFNDVFRVAISQTALQ
QKTLRVDLCSVSKHRREECLAGTQISLADLPFSSEVFTLWYNLLPSKQMPCKKNEENEDS
VFQPNQPLVDSIDLDAVSALLARTSAELLAVEQELAQEEEEESGQEEPRGPDGDWLTMLR
EASDEIVAEKEAEVKLPEDSSCTEDLSSCTSVPEMNEDGNRKESNCAKDLRSQPPTRIPT
LVDKETNTDEAANDNMAVRPKERSSLSSRQHPFVRSSVIVRSQTFSPGERNQYICRLNRS
DSDSSTLAKKSLFVRNSTERRSLRVKRTVCQSVLRRTTQECPVRTSLDLELDLQASLTRQ
SRLNDELQALRDLRQKLEELKAQGETDLPPGVLEDERFQRLLKQAEKQAEQSKEEQKQGL
NAEKLMRQVSKDVCRLREQSQKVPRQVQSFREKIAYFTRAKISIPSLPADDV
NT seq 3579 nt   +upstreamnt  +downstreamnt
atgcctaggagggccgggagcggtcagctgccgctgccccggggctgggaggaggccagg
gactacgacggcaaggtcttctacattgaccacaacaccaggaggaccagctggatcgac
ccccgggacaggttaacgaagcccttgtcatttgctgattgtgttggggatgagctgccg
tggggatgggaagcagggtttgaccctcagattggtgtctactacatcgatcacatcaac
aaaaccacgcagatagaagatccaagaaaacaatggaggggggaacaggagaagatgctc
aaggactacctctctgtggcacaggatgccctccggacacagaaggaactgtaccatgtg
aaggagcagaggctggcgctggccctggatgaatacgtgcgattaaatgatgcctataag
gaaaagtcaagttctcacacaagcttattctcaggatcttcatccagtactaaatatgat
cccgatattttaaaagctgagatctccactacaagattaagggttaaaaagctaaagaga
gagctctcacagatgaagcaggaactgctctataaagaacaaggctttgaaacattgcag
caaattgataaaaaaatgtctggaggccagagcgggtatgaactcagtgaagccaaagcc
attctaacagaactaaaatctatcagaaaggcaattagctcaggagaaaaagaaaaacaa
gatctgatgcagagtcttgctaagctgcaggagcggtttcatttggatcagaacattggc
agatctgagccagatttgagatgtagtcctgtgaactctcatttatgtctctccagacag
acccttgatgctgggtcacaaacaagcatttccggagatattggagtaagaagtagatca
aatttagctgaaaaggtcaggctaagcctacagtatgaagaagccaaaagaagtatggcc
aacttaaaaattgaactgtcaaaattggacagtgaggcctggcctggggcactggatatt
gagaaggaaaaactgatgctgattaatgaaaaagaagaacttttgaaagagcttcagttc
gtcaccccacagaaacgtacccaagatgaattagaacgcctagaagctgaaaggcagcgg
ctggaagaagagttgctgtctgtgaggggaacaccaagcagagctctggccgagagattg
agattggaagagagaagaaaagagctgctacagaaacttgaagaaactactaaattaact
acttatttgcattcacaacttaaaagcctctctgccagcaccctgtccatgtcatctggg
agcagcctgggttccctggcatcgagtcggggctctctgaacacctccagcagagggtca
ctcaactccctcagttccaccgaactctattacagcagtcaaagtgatcagatagatgtg
gattatcagtataaactggacttccttctgcaagagaaaagcggttacattccttctgga
cccatcaccaccatccatgaaaacgaggtggtcaagtcccctagccagcctggccagagt
ggactctgtggagtggcagctgcagcaacaggccacactcctccactggctgaggccccg
aagtctgtggcctccctgtcctcgaggtcctccctttcctccttgtctcctccaggctct
cccttggttttggaaggcacgtttcccatgtcttcttctcatgatgcctctctccatcag
ttcactgctgactttgaagactgtgagttgagtagccattttgcagatatcagcctcatc
gaaaatcagattttgctggattctgattcaggaggagcctcccagtctctttcagaggat
aaagaccttaatgaatgtgctagggagccattatatgaaggaactgcagatgtggaaaaa
tcattaccaaaaagaagagtgatccacttgcttggggagaaaaccacttgtgtgtcggct
gctgtgtctgatgagtctgtggctggagacagtggggtctatgaagctttcgtgaaacaa
cctagtgaaatggaagatgtcacatacagtgaagaggatgtagccattgtagagaccgcc
caggttcagataggactcagatacaatgcaaaaagttcaagtttcatggtgattatagca
cagctccgaaaccttcatgccttcttgatacctcatacttcaaaagtatattttagggtt
gccgttcttccttcctcaactgatgtcagctgtctgtttcgcacaaaagttcatccgccc
acagaatccattttattcaatgatgtgttcagagtcgccatttcccaaacagccttacaa
cagaagacactgagggtagacctttgctctgtcagtaaacaccgaagggaagaatgcctg
gctggaactcagatcagcctggcagatttaccattttccagtgaggttttcactctatgg
tataacttgcttccttccaagcaaatgccttgcaaaaagaatgaagaaaatgaggactct
gtatttcaaccaaaccagccgttagtagattctatagacttggatgcagtgtcagcctta
cttgcaagaacatcagctgagttgttagctgtggaacaagaattagcacaagaagaagaa
gaagaatcaggacaagaagagccaaggggcccagatggagactggctaacaatgctaaga
gaggcctctgatgaaattgtggctgaaaaagaggctgaagttaaattgccagaggacagt
agctgtacagaagatttaagttcatgcactagtgtgcctgagatgaatgaagacgggaac
aggaaagaaagcaactgtgccaaagacctcagaagtcagccacctactagaataccaaca
ctggttgacaaagagacaaacactgatgaagccgctaatgacaatatggcagttcgcccc
aaagagcgcagcagcctgagctctagacagcatccgtttgtgaggagcagtgtgatagtg
cgctcacagaccttttctccaggagagcggaaccagtacatctgcaggttaaatcggagt
gacagtgacagttcaaccctggctaaaaaatcactgtttgtgagaaactccaccgaacgc
cgcagtttgagggtcaaaaggacggtttgccagtcagtccttagaagaacaacacaggaa
tgcccagtgcggacatctctagacttagaactggaccttcaggcatctctgacccggcag
agccgcctcaatgatgagctgcaggcgctgagggacttgcggcagaagctggaggaactg
aaagctcagggagagactgaccttccaccaggcgtgctggaggatgagaggttccagagg
cttctgaagcaagctgagaagcaggctgaacagtccaaagaagagcagaagcaaggtctg
aatgcagagaagttgatgaggcaagtctccaaggacgtgtgtcggctccgggagcagagc
cagaaggtgcctcggcaggtgcagtccttcagggagaagattgcctacttcaccagagca
aagataagcatcccatccctgccagctgatgatgtgtga

DBGET integrated database retrieval system