KEGG   Homo sapiens (human): 80263
Entry
80263             CDS       T01001                                 
Symbol
TRIM45, RNF99
Name
(RefSeq) tripartite motif containing 45
  KO
K12021  tripartite motif-containing protein 45
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    80263 (TRIM45)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    80263 (TRIM45)
SSDB
Motif
Pfam: Filamin zf-B_box zf-RING_UBOX zf-C3HC4 Invasin_D3 ATP-synt_ab_C ANCHR-like_BBOX zf-C3HC4_4 DegS BAR Apolipoprotein HIP1_clath_bdg Y_Y_Y Big_1
Other DBs
NCBI-GeneID: 80263
NCBI-ProteinID: NP_079464
OMIM: 609318
HGNC: 19018
Ensembl: ENSG00000134253
UniProt: Q9H8W5
Position
1:complement(117111060..117123927)
AA seq 580 aa
MSENRKPLLGFVSKLTSGTALGNSGKTHCPLCLGLFKAPRLLPCLHTVCTTCLEQLEPFS
VVDIRGGDSDTSSEGSIFQELKPRSLQSQIGILCPVCDAQVDLPMGGVKALTIDHLAVND
VMLESLRGEGQGLVCDLCNDREVEKRCQTCKANLCHFCCQAHRRQKKTTYHTMVDLKDLK
GYSRIGKPILCPVHPAEELRLFCEFCDRPVCQDCVVGEHREHPCDFTSNVIHKHGDSVWE
LLKGTQPHVEALEEALAQIHIINSALQKRVEAVAADVRTFSEGYIKAIEEHRDKLLKQLE
DIRAQKENSLQLQKAQLEQLLADMRTGVEFTEHLLTSGSDLEILITKRVVVERLRKLNKV
QYSTRPGVNDKIRFCPQEKAGQCRGYEIYGTINTKEVDPAKCVLQGEDLHRAREKQTASF
TLLCKDAAGEIMGRGGDNVQVAVVPKDKKDSPVRTMVQDNKDGTYYISYTPKEPGVYTVW
VCIKEQHVQGSPFTVMVRRKHRPHSGVFHCCTFCSSGGQKTARCACGGTMPGGYLGCGHG
HKGHPGHPHWSCCGKFNEKSECTWTGGQSAPRSLLRTVAL
NT seq 1743 nt   +upstreamnt  +downstreamnt
atgtcagaaaacagaaaaccgctgctgggctttgtaagcaaactcactagtgggactgca
cttgggaactcaggcaagactcactgccccctgtgcttggggcttttcaaagcccccagg
ctcttgccttgtttgcatacagtttgcaccacgtgtctggagcagctggagcccttctca
gtagtggacatccgagggggagactctgacacaagctctgaggggtcaatattccaggaa
ctcaagccacgaagtctgcagtcgcagatcggcatcctttgtcctgtatgtgatgctcag
gtggacctgcccatgggtggagtgaaggctttaaccatagaccacctggccgtgaatgat
gtgatgctggagagcctacgtggggaaggccagggcctggtgtgtgacctgtgcaacgac
agggaagtagagaagaggtgtcagacctgcaaagccaacctctgccacttctgctgccag
gctcataggcggcagaagaaaacgacttaccacaccatggtggacctaaaagacttgaaa
ggctacagccggattgggaagcccatcctgtgtcctgttcaccctgcagaggaactgagg
ctgttctgtgagttctgtgaccggcccgtgtgccaggattgtgtggtgggggagcatcgg
gaacacccctgtgacttcaccagcaatgtcatccacaagcatggggactctgtgtgggag
ctcctcaaaggtactcagccccacgtggaggccctggaggaagccctggctcagatccac
ataataaacagtgccctccagaagcgagtggaggcagtggcagctgatgtccggacattc
tcggagggctacattaaggccattgaggagcatcgggacaagctgctgaagcagctggaa
gacatacgggcccagaaggaaaattccctgcagctgcagaaggcccagctggaacagtta
ctggcagacatgcggactggagtggagttcaccgagcacttgctgaccagcggctcagac
ttggagatcctcatcaccaagagggtggtggtagaacggctcaggaagctgaacaaagtt
caatatagcacccgtcctggagtaaatgataagatacgcttctgtcctcaggagaaagca
ggccagtgccgtggctatgaaatttatggtacgattaataccaaagaggttgatccagcc
aaatgtgtcctacaaggagaagacctccacagagcccgggagaaacagacggcctctttc
accctgctttgtaaggatgccgcaggagaaatcatgggcaggggaggagacaacgttcaa
gttgccgttgtccctaaagataagaaagacagcccagtcagaacaatggtccaggataac
aaggatgggacatactacatttcctacacccccaaggaacctggcgtctatactgtgtgg
gtctgcatcaaagaacagcatgtgcagggctcgccattcactgtgatggtgaggagaaag
caccgcccacactcaggcgtgtttcactgctgcaccttctgctccagcgggggccagaaa
accgctcgctgcgcctgtggaggcaccatgccaggtgggtacctaggctgtggccatgga
cacaaaggccacccaggtcatccccactggtcatgctgtggaaaatttaatgagaaatct
gaatgcacatggacaggtgggcagagcgcaccgaggagtctacttaggactgtggctctc
tga

DBGET integrated database retrieval system