KEGG   Homo sapiens (human): 80264
Entry
80264             CDS       T01001                                 

Gene name
ZNF430
Definition
(RefSeq) zinc finger protein 430
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    80264 (ZNF430)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    80264 (ZNF430)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    80264 (ZNF430)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_6 zf-C2H2_jaz Zn-ribbon_8 XPA_N zf_UBZ zf-C2H2_11 zf-RING_7 zinc_ribbon_15 zf-C2H2_8 zf-AN1 ADK_lid PknG_rubred zf-C2HE
Other DBs
NCBI-GeneID: 80264
NCBI-ProteinID: NP_079465
HGNC: 20808
Ensembl: ENSG00000118620
Vega: OTTHUMG00000182771
Pharos: Q9H8G1(Tbio)
UniProt: Q9H8G1 A8K360
Position
19p12
AA seq 570 aa
MENLKSGVYPLKEASGCPGADRNLLVYSFYEKGPLTFRDVAIEFSLEEWQCLDTAQQDLY
RKVMLENYRNLVFLAGIAVSKPDLITCLEQGKEPWNMKRHAMVDQPPVTYSHFAQDLWPE
QGIKDSFQEVILRRYGKCGHEDLQLRTGCKSVDECNLHKECYDELNQCLTTTQSEIFQYD
KYVNVFYKFSNPNIQKIRHTGKKPFKCKKCDKSFCMLLHLTQHKRIHIRENSYQCEECGK
VFNWFSTLTRHRRIHTGEKPYKCEQCGKAFKQSSTLTTHKIIHTGEKPYRCEECGKTFNR
SSHLTTHKRIHTGEKPYRCEECGRAFNRSSHLTTHKIIHTGEKPYKCEECGKAFNQSSTL
TTHKIIHAGEKPYKCEECGKAFYRFSYLTKHKIIHTGEKFYKCEECGKGFNWSSTLTKHK
RIHTGEKPYKCEQCGKAFNESSNLTAHKIIHTGEKPYKCEECGKAFNRSPKLTAHKVIHS
GEKPYKCEECGKAFNQFSNLTKHKITHIGDTSYKYLECDKAFSQSSTLTKHKVIHTGEKP
YNCEEYGKAFNQSSNLIEQSNSYWRETLQM
NT seq 1713 nt   +upstreamnt  +downstreamnt
atggagaacctgaagtctggagtgtatcctctcaaggaagcaagtggatgccctggggct
gacaggaatcttctggtgtactctttttatgaaaaggggccattgacatttagggatgtg
gccatagaattttctctggaggagtggcaatgcctggacactgctcagcaggatttgtat
agaaaagtgatgttagagaactacagaaacctggtcttcttggcaggtattgctgtttct
aagccagacctgatcacctgtctagagcaaggaaaagagccctggaatatgaagagacat
gcgatggtagatcaacccccagttacatattctcattttgcccaagacctttggccagag
cagggcataaaagattctttccaagaagtcatattgagaagatatggaaaatgtggacat
gaagatttacagttaagaacaggctgtaaaagtgtggatgagtgtaatctgcacaaagaa
tgttatgatgaactaaaccagtgtttgacaactacccagagtgaaatatttcaatatgat
aaatatgtgaatgtcttttataaattttcaaatccaaatatacaaaagataagacatact
ggaaagaagcctttcaaatgtaaaaaatgtgacaaatcgttttgcatgcttttacaccta
actcaacataaaagaattcatattagggaaaattcttaccaatgtgaagaatgtggtaaa
gtctttaactggttctcaacccttactagacacagaagaattcatactggagagaaaccc
tacaaatgtgaacaatgtggcaaagcttttaagcagtcctcaacccttactacacataag
ataattcatactggagagaaaccctacagatgtgaagaatgtggcaaaacctttaaccgg
tcctcacaccttactacacataaaagaattcatactggagagaaaccctacagatgtgaa
gaatgtggcagagcttttaaccggtcctcacaccttactacacataagattattcatact
ggagagaaaccctacaaatgtgaagaatgtggcaaagcttttaaccaatcctcaaccctt
actacacataagataattcatgctggagagaaaccttacaaatgtgaagaatgtggcaaa
gctttttaccgattctcataccttactaaacataagataattcatactggagagaaattc
tacaaatgtgaagaatgtggcaaaggctttaattggtcctcgacccttactaaacataaa
agaattcatactggagagaaaccctacaaatgtgaacaatgtggcaaagcttttaatgag
tcctcaaaccttactgcacataagataattcatactggagagaaaccctacaaatgtgaa
gaatgtggcaaagcctttaaccggtccccaaaacttactgcacataaggtaattcattct
ggagagaaaccctacaaatgtgaagaatgtggcaaagcttttaaccaattctcaaacctt
actaaacataagataactcatattggagatacatcttacaaatacctagaatgtgataaa
gcctttagccagtcttcaactcttactaaacataaggtaattcatactggagagaaaccc
tacaactgtgaagaatacggcaaagctttcaaccagtcctcaaaccttattgaacaaagt
aattcatactggagagaaaccctacaaatgtga

DBGET integrated database retrieval system