KEGG   Homo sapiens (human): 80279
Entry
80279             CDS       T01001                                 
Symbol
CDK5RAP3, C53, HSF-27, IC53, LZAP, MST016, OK/SW-cl.114, PP1553
Name
(RefSeq) CDK5 regulatory subunit associated protein 3
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: CDK5RAP3 TrbK
Other DBs
NCBI-GeneID: 80279
NCBI-ProteinID: NP_788276
OMIM: 608202
HGNC: 18673
Ensembl: ENSG00000108465
Pharos: Q96JB5(Tbio)
UniProt: Q96JB5
Position
17:47967904..47981781
AA seq 506 aa
MEDHQHVPIDIQTSKLLDWLVDRRHCSLKWQSLVLTIREKINAAIQDMPESEEIAQLLSG
SYIHYFHCLRILDLLKGTEASTKNIFGRYSSQRMKDWQEIIALYEKDNTYLVELSSLLVR
NVNYEIPSLKKQIAKCQQLQQEYSRKEEECQAGAAEMREQFYHSCKQYGITGENVRGELL
ALVKDLPSQLAEIGAAAQQSLGEAIDVYQASVGFVCESPTEQVLPMLRFVQKRGNSTVYE
WRTGTEPSVVERPHLEELPEQVAEDAIDWGDFGVEAVSEGTDSGISAEAAGIDWGIFPES
DSKDPGGDGIDWGDDAVALQITVLEAGTQAPEGVARGPDALTLLEYTETRNQFLDELMEL
EIFLAQRAVELSEEADVLSVSQFQLAPAILQGQTKEKMVTMVSVLEDLIGKLTSLQLQHL
FMILASPRYVDRVTEFLQQKLKQSQLLALKKELMVQKQQEALEEQAALEPKLDLLLEKTK
ELQKLIEADISKRYSGRPVNLMGTSL
NT seq 1521 nt   +upstreamnt  +downstreamnt
atggaggaccatcagcacgtgcccatcgacatccagaccagcaagctgctcgattggctg
gtggacagaaggcactgcagcctgaaatggcagagtctggtgctgacgatccgcgagaag
atcaatgctgccatccaggacatgccagagagcgaagagatcgcccagctgctgtctggg
tcctacattcactactttcactgcctaagaatcctggaccttctcaaaggcacagaggcc
tccacgaagaatatttttggccgatactcttcacagcggatgaaggattggcaggagatt
atagctctgtatgagaaggacaacacctacttagtggaactctctagcctcctggttcgg
aatgtcaactatgagatcccctcactgaagaagcagattgccaagtgccagcagctgcag
caagaatacagccgcaaggaggaggagtgccaggcaggggctgccgagatgcgggagcag
ttctaccactcctgcaagcagtatggcatcacgggcgaaaatgtccgaggagaactgctg
gccctggtgaaggacctgccgagtcagctggctgagattggggcagcggctcagcagtcc
ctgggggaagccattgacgtgtaccaggcgtctgtggggtttgtgtgtgagagccccaca
gagcaggtgttgccaatgctgcggttcgtgcagaagcggggaaactcaacggtgtacgag
tggaggacagggacagagccctctgtggtggaacgaccccacctcgaggagcttcctgag
caggtggcagaagatgcgattgactggggcgactttggggtagaggcagtgtctgagggg
actgactctggcatctctgccgaggctgctggaatcgactggggcatcttcccggaatca
gattcaaaggatcctggaggtgatgggatagactggggagacgatgctgttgctttgcag
atcacagtgctggaagcaggaacccaggctccagaaggtgttgccaggggcccagatgcc
ctgacactgcttgaatacactgagacccggaatcagttccttgatgagctcatggagctt
gagatcttcttagcccagagagcagtggagttgagtgaggaggcagatgtcctgtctgtg
agccagttccagctggctccagccatcctgcagggccagaccaaagagaagatggttacc
atggtgtcagtgctggaggatctgattggcaagcttaccagtcttcagctgcaacacctg
tttatgatcctggcctcaccaaggtatgtggaccgagtgactgaattcctccagcaaaag
ctgaagcagtcccagctgctggctttgaagaaagagctgatggtgcagaagcagcaggag
gcacttgaggagcaggcggctctggagcctaagctggacctgctactggagaagaccaag
gagctgcagaagctgattgaagctgacatctccaagaggtacagcgggcgccctgtgaac
ctgatgggaacctctctgtga

DBGET integrated database retrieval system