KEGG   Homo sapiens (human): 8034
Entry
8034              CDS       T01001                                 

Gene name
SLC25A16, D10S105E, GDA, GDC, HGT.1, ML7, hML7
Definition
(RefSeq) solute carrier family 25 member 16
  KO
K15084  solute carrier family 25 (mitochondrial carrier protein), member 16
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    8034 (SLC25A16)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   8034 (SLC25A16)
SSDB
Motif
Pfam: Mito_carr SLC25_like
Other DBs
NCBI-GeneID: 8034
NCBI-ProteinID: NP_689920
OMIM: 139080
HGNC: 10986
Ensembl: ENSG00000122912
Vega: OTTHUMG00000018354
Pharos: P16260(Tdark)
UniProt: P16260
Position
10q21.3
AA seq 332 aa
MAAATAAAALAAADPPPAMPQAAGAGGPTTRRDFYWLRSFLAGGIAGCCAKTTVAPLDRV
KVLLQAHNHHYKHLGVFSALRAVPQKEGFLGLYKGNGAMMIRIFPYGAIQFMAFEHYKTL
ITTKLGISGHVHRLMAGSMAGMTAVICTYPLDMVRVRLAFQVKGEHSYTGIIHAFKTIYA
KEGGFFGFYRGLMPTILGMAPYAGVSFFTFGTLKSVGLSHAPTLLGRPSSDNPNVLVLKT
HVNLLCGGVAGAIAQTISYPFDVTRRRMQLGTVLPEFEKCLTMRDTMKYVYGHHGIRKGL
YRGLSLNYIRCIPSQAVAFTTYELMKQFFHLN
NT seq 999 nt   +upstreamnt  +downstreamnt
atggcggcggcgacggccgcggcagccctggcggcggccgatccccctcccgcaatgccg
caggcggcaggggccggagggcccacaacccgcagagacttctactggctgcgctccttt
ctggccggaggtattgctggatgctgtgccaaaacaacagttgctccattggatcgagta
aaggttttattacaagctcacaatcaccattacaagcatttaggagtattttctgcattg
cgtgctgttcctcaaaaagaaggattccttggattgtataaaggaaatggtgcaatgatg
attcgaatctttccctatggtgcaatccagtttatggcatttgagcattataaaacgtta
attactacgaagctgggaatttcaggtcatgtgcacagattaatggctggatccatggca
ggtatgacagcagttatctgtacttaccctcttgacatggttagggtccgcctagcattc
caggtgaaaggggaacacagctatacaggaattattcatgctttcaaaacaatttatgca
aaggaaggtggtttctttggattttacagaggtctgatgcctactattttaggaatggct
ccatatgcaggtgtttcattttttacttttggtaccttgaagagtgttgggctttcccat
gctcctacccttcttggcagaccttcatcagacaatcctaatgtcttagttttgaaaact
catgtaaacttactttgtggtggtgttgctggagcaatagcgcagacaatatcctaccca
tttgatgtgactcgtcggcgaatgcaattaggaactgttctgccggaatttgaaaagtgc
cttaccatgcgggatactatgaagtatgtctatggacaccatggaattcgaaaaggactc
tatcgtggtttatctcttaattacattcgctgtattccctctcaagcagtggcttttaca
acatacgaacttatgaagcagttttttcacctcaactaa

DBGET integrated database retrieval system