KEGG   Homo sapiens (human): 80349Help
Entry
80349             CDS       T01001                                 

Gene name
WDR61, REC14, SKI8
Definition
(RefSeq) WD repeat domain 61
  KO
K12602  WD repeat-containing protein 61
Organism
hsa  Homo sapiens (human)
Pathway
hsa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    80349 (WDR61)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    80349 (WDR61)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Ski complex
     80349 (WDR61)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 eIF2A Ge1_WD40 Cytochrom_D1 Nup160 HPS3_N GSDH Frtz WD40_like Nucleoporin_N DUF2415
Motif
Other DBs
NCBI-GeneID: 80349
NCBI-ProteinID: NP_001290176
OMIM: 609540
HGNC: 30300
Ensembl: ENSG00000140395
Vega: OTTHUMG00000143735
Pharos: Q9GZS3(Tbio)
UniProt: Q9GZS3
Structure
PDB: 

Position
15q25.1
AA seq 305 aa AA seqDB search
MTNQYGILFKQEQAHDDAIWSVAWGTNKKENSETVVTGSLDDLVKVWKWRDERLDLQWSL
EGHQLGVVSVDISHTLPIAASSSLDAHIRLWDLENGKQIKSIDAGPVDAWTLAFSPDSQY
LATGTHVGKVNIFGVESGKKEYSLDTRGKFILSIAYSPDGKYLASGAIDGIINIFDIATG
KLLHTLEGHAMPIRSLTFSPDSQLLVTASDDGYIKIYDVQHANLAGTLSGHASWVLNVAF
CPDDTHFVSSSSDKSVKVWDVGTRTCVHTFFDHQDQVWGVKYNGNGSKIVSVGDDQEIHI
YDCPI
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaccagtacggtattctcttcaaacaagagcaagcccatgatgatgccatttgg
tcagttgcttgggggacaaacaagaaggaaaactctgagacagtggtcacaggctcccta
gatgacctggtgaaggtctggaaatggcgtgatgagaggctggacctacagtggagtctg
gagggacatcagctgggagtggtgtctgtggacatcagccacaccctgcccattgctgca
tccagctctcttgatgctcatattcgtctttgggacttggaaaatggcaaacagataaag
tccatagatgcaggacctgtggatgcctggactttggccttttctcctgattcccagtat
ctggccacaggaactcatgtcgggaaagtgaacatttttggtgtggaaagtgggaaaaag
gaatattctttggacacgagaggaaaattcattcttagtattgcatatagtcctgatggg
aaatacctagccagtggagccatagatggaatcatcaatatttttgatattgcaactgga
aaacttctgcataccctggaaggccatgccatgcccattcgctccttgaccttttccccg
gactcccagctccttgtcactgcttcagatgatggctacatcaagatctatgatgtacaa
catgccaatttggctggcacgctgagcggccatgcctcctgggtgctgaacgttgcattc
tgtcctgatgacactcactttgtttccagttcgtctgacaaaagtgtaaaagtttgggat
gttggaacgaggacttgtgttcacaccttctttgatcaccaggatcaggtctggggagta
aaatacaatggaaatggttcaaaaattgtgtctgttggagatgaccaggaaattcacatc
tatgattgtccaatttaa

DBGET integrated database retrieval system