KEGG   Homo sapiens (human): 820Help
Entry
820               CDS       T01001                                 

Gene name
CAMP, CAP-18, CAP18, CRAMP, FALL-39, FALL39, HSD26, LL37
Definition
(RefSeq) cathelicidin antimicrobial peptide
  KO
K13916  cathelicidin antimicrobial peptide
Organism
hsa  Homo sapiens (human)
Pathway
hsa04621  NOD-like receptor signaling pathway
hsa04970  Salivary secretion
hsa05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    820 (CAMP)
  09154 Digestive system
   04970 Salivary secretion
    820 (CAMP)
 09160 Human Diseases
  09171 Infectious diseases: Bacterial
   05152 Tuberculosis
    820 (CAMP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cathelicidins CAP18_C Spp-24
Motif
Other DBs
NCBI-GeneID: 820
NCBI-ProteinID: NP_004336
OMIM: 600474
HGNC: 1472
Ensembl: ENSG00000164047
Vega: OTTHUMG00000133526
Pharos: P49913(Tbio)
CPD: C18313
UniProt: P49913 J3KNB4
Structure
PDB: 

Position
3p21.31
AA seq 173 aa AA seqDB search
MGTMKTQRDGHSLGRWSLVLLLLGLVMPLAIIAQVLSYKEAVLRAIDGINQRSSDANLYR
LLDLDPRPTMDGDPDTPKPVSFTVKETVCPRTTQQSPEDCDFKKDGLVKRCMGTVTLNQA
RGSFDISCDKDNKRFALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggggaccatgaagacccaaagggatggccactccctggggcggtggtcactggtgctc
ctgctgctgggcctggtgatgcctctggccatcattgcccaggtcctcagctacaaggaa
gctgtgcttcgtgctatagatggcatcaaccagcggtcctcggatgctaacctctaccgc
ctcctggacctggaccccaggcccacgatggatggggacccagacacgccaaagcctgtg
agcttcacagtgaaggagacagtgtgccccaggacgacacagcagtcaccagaggattgt
gacttcaagaaggacgggctggtgaagcggtgtatggggacagtgaccctcaaccaggcc
aggggctcctttgacatcagttgtgataaggataacaagagatttgccctgctgggtgat
ttcttccggaaatctaaagagaagattggcaaagagtttaaaagaattgtccagagaatc
aaggattttttgcggaatcttgtacccaggacagagtcctag

DBGET integrated database retrieval system