KEGG   Homo sapiens (human): 83480Help
Entry
83480             CDS       T01001                                 

Gene name
PUS3, 2610020J05Rik, FKSG32, MRT55
Definition
(RefSeq) pseudouridine synthase 3
  KO
K01855  tRNA pseudouridine38/39 synthase [EC:5.4.99.45]
Organism
hsa  Homo sapiens (human)
Disease
H00768  Autosomal recessive mental retardation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hsa03016]
    83480 (PUS3)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.45  tRNA pseudouridine38/39 synthase
     83480 (PUS3)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic type
  tRNA modification factors
   Psudouridine synthases
    83480 (PUS3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PseudoU_synth_1
Motif
Other DBs
NCBI-GeneID: 83480
NCBI-ProteinID: NP_112597
OMIM: 616283
HGNC: 25461
Ensembl: ENSG00000110060
Vega: OTTHUMG00000165870
Pharos: Q9BZE2(Tbio)
UniProt: Q9BZE2
Position
11q24.2
AA seq 481 aa AA seqDB search
MAYNDTDRNQTEKLLKRVRELEQEVQRLKKEQAKNKEDSNIRENSAGAGKTKRAFDFSAH
GRRHVALRIAYMGWGYQGFASQENTNNTIEEKLFEALTKTRLVESRQTSNYHRCGRTDKG
VSAFGQVISLDLRSQFPRGRDSEDFNVKEEANAAAEEIRYTHILNRVLPPDIRILAWAPV
EPSFSARFSCLERTYRYFFPRADLDIVTMDYAAQKYVGTHDFRNLCKMDVANGVINFQRT
ILSAQVQLVGQSPGEGRWQEPFQLCQFEVTGQAFLYHQVRCMMAILFLIGQGMEKPEIID
ELLNIEKNPQKPQYSMAVEFPLVLYDCKFENVKWIYDQEAQEFNITHLQQLWANHAVKTH
MLYSMLQGLDTVPVPCGIGPKMDGMTEWGNVKPSVIKQTSAFVEGVKMRTYKPLMDRPKC
QGLESRIQHFVRRGRIEHPHLFHEEETKAKRDCNDTLEEENTNLETPTKRVCVDTEIKSI
I
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atggcttataatgacacagacagaaaccagactgagaagctcctaaaaagagtacgagaa
ctggagcaagaggtgcaaagacttaaaaaggaacaggccaaaaataaggaggactcaaac
attagagaaaattcagcaggagctggaaaaactaagcgtgcatttgatttcagtgctcat
ggccgaagacacgtagccctaagaatagcctatatgggctggggataccagggctttgct
agtcaggaaaacacaaataataccattgaagagaaactgtttgaagctctaaccaagact
cgactagtagaaagcagacagacatccaactatcaccgatgtgggagaacagataaagga
gttagtgcctttggacaggtgatctcacttgaccttcgctctcagtttccaaggggcagg
gattccgaggactttaatgtaaaagaggaggctaatgctgctgctgaagagatccgttat
acccacattctcaatcgggtactccctccagacatccgtatattggcctgggcccctgta
gaaccaagcttcagtgctaggttcagctgccttgagcggacttaccgctattttttccct
cgtgctgatttagatattgtaaccatggattatgcagctcagaagtatgttggcacccat
gatttcaggaacttgtgtaaaatggatgtagccaacggtgtgattaattttcagaggact
attctatctgctcaagtacagctagtgggccagagcccaggtgaggggagatggcaagaa
cctttccagttatgtcagtttgaagtgactggccaggcattcctttatcatcaagtccga
tgtatgatggctatcctctttctgattggccaaggaatggagaagccagagattattgat
gagctgctgaatatagagaaaaatccccaaaagcctcaatatagtatggctgtagaattt
cctctagtcttatatgactgtaagtttgaaaatgtcaagtggatctatgaccaggaggct
caggagttcaatattacccacctacaacaactgtgggctaatcatgctgtcaaaactcac
atgttgtatagtatgctacaaggactggacactgttccagtaccctgtggaataggacca
aagatggatggaatgacagaatggggaaatgttaagccctctgtcataaagcagaccagt
gcctttgtagaaggagtgaagatgcgcacatataagcccctcatggaccgtcctaaatgc
caaggactggaatcccggatccagcattttgtacgtaggggacgaattgagcacccacat
ttattccatgaggaagaaacaaaagccaaaagggactgtaatgacacactagaggaagag
aatactaatttggagacaccaacgaagagggtctgtgttgacacagaaattaaaagcatc
atttaa

DBGET integrated database retrieval system