KEGG   Homo sapiens (human): 84078Help
Entry
84078             CDS       T01001                                 

Gene name
KBTBD7
Definition
(RefSeq) kelch repeat and BTB domain containing 7
  KO
K10474  kelch repeat and BTB domain-containing protein 6/7
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    84078 (KBTBD7)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     84078 (KBTBD7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BTB BACK Kelch_1 Kelch_6 Kelch_3 Kelch_4 Kelch_2 DUF3342 PT-TG
Motif
Other DBs
NCBI-GeneID: 84078
NCBI-ProteinID: NP_115514
OMIM: 617739
HGNC: 25266
Ensembl: ENSG00000120696
Vega: OTTHUMG00000016789
Pharos: Q8WVZ9(Tdark)
UniProt: Q8WVZ9
Position
13q14.11
AA seq 684 aa AA seqDB search
MQSREDVPRSRRLASPRGGRRPKRISKPSVSAFFTGPEELKDTAHSAALLAQLKSFYDAR
LLCDVTIEVVTPGSGPGTGRLFSCNRNVLAAACPYFKSMFTGGMYESQQASVTMHDVDAE
SFEVLVDYCYTGRVSLSEANVQRLYAASDMLQLEYVREACASFLARRLDLTNCTAILKFA
DAFDHHKLRSQAQSYIAHNFKQLSRMGSIREETLADLTLAQLLAVLRLDSLDIESERTVC
HVAVQWLEAAAKERGPSAAEVFKCVRWMHFTEEDQDYLEGLLTKPIVKKYCLDVIEGALQ
MRYGDLLYKSLVPVPNSSSSSSSSNSLVSAAENPPQRLGMCAKEMVIFFGHPRDPFLCYD
PYSGDIYTMPSPLTSFAHTKTVTSSAVCVSPDHDIYLAAQPRKDLWVYKPAQNSWQQLAD
RLLCREGMDVAYLNGYIYILGGRDPITGVKLKEVECYSVQRNQWALVAPVPHSFYSFELI
VVQNYLYAVNSKRMLCYDPSHNMWLNCASLKRSDFQEACVFNDEIYCICDIPVMKVYNPA
RGEWRRISNIPLDSETHNYQIVNHDQKLLLITSTTPQWKKNRVTVYEYDTREDQWINIGT
MLGLLQFDSGFICLCARVYPSCLEPGQSFITEEDDARSESSTEWDLDGFSELDSESGSSS
SFSDDEVWVQVAPQRNAQDQQGSL
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atgcagtcccgggaagacgtcccgcgctctcgccgcctcgccagtccccgtggtgggagg
cggcccaagaggatttccaagccctcggtttcggcctttttcacgggtccagaggagtta
aaggacacggcccattctgcagccctgctggcacagctcaagtccttctacgacgcgcgg
ctgctgtgtgatgtgaccatcgaggtggtgacgcctggcagcgggcctggcacgggtcgc
ctcttttcctgcaatcgcaacgtgctagcagctgcgtgtccctacttcaagagcatgttc
acaggtggcatgtacgagagccagcaggccagcgtgaccatgcacgatgtggacgccgag
tccttcgaggtgttggtcgactactgctacacgggtcgtgtgtctctcagtgaggccaat
gtgcagcgcctgtacgcggcctccgacatgctacagctggaatatgtgcgggaagcctgt
gcctccttcttagcccgacgtcttgacctgaccaactgcaccgccatcctcaagtttgca
gacgccttcgaccatcacaagcttcgatctcaggcccagtcctacatagctcacaacttc
aagcagctcagccgaatgggttcaattcgggaggagactctagcagatctaaccctggcc
cagctgctggctgtcctacgcctggatagtctggacatagagagtgagcggactgtatgc
catgtagctgtgcagtggctggaggctgctgccaaagagcggggtcccagtgctgcagaa
gtcttcaagtgcgtgcgctggatgcacttcactgaagaagatcaggactacttagaaggg
ctgctgaccaagcccatcgtgaagaagtactgcctggacgttattgaaggggccctgcag
atgcgctatggtgacctgttgtacaagtctctggtgccagtgccaaacagcagcagcagc
agtagcagcagcaactctcttgtatctgcagcagaaaatccaccccagagactgggtatg
tgtgccaaggagatggtgatcttctttggacatcctagagatccctttctctgctatgac
ccttactcgggggacatttacacaatgccatcccctttgaccagctttgctcacactaag
actgtcacctcctcagctgtctgtgtgtccccagaccatgacatctatctagctgctcag
cccaggaaagacctctgggtgtataaaccagctcagaatagttggcagcaacttgcagat
cgcttgctgtgtcgtgagggcatggatgtggcatatctcaatggctacatctacattttg
gggggacgagaccctattactggagttaagttgaaggaagtggaatgctacagtgttcag
agaaaccagtgggcattggtggctcctgtccctcattccttctattcctttgaactcata
gtggttcagaactatctttatgctgtcaacagtaagcgcatgctttgctatgatcctagc
cacaatatgtggctgaactgtgcttctcttaaacgtagtgactttcaggaagcatgtgtc
ttcaatgatgaaatctattgtatctgtgacatcccagtcatgaaggtctacaacccagct
aggggagaatggaggcggattagtaatattcctttggattcagagacccacaactaccag
attgtcaatcatgaccaaaagttgcttctcatcacttctacaaccccacaatggaaaaag
aaccgagtgacagtgtatgagtatgatactagggaagatcagtggattaatataggtacc
atgttaggccttttgcagtttgactctggctttatttgcctttgtgctcgtgtttatcct
tcctgccttgaacctggtcagagttttattactgaggaagatgatgcacggagtgagtct
agtactgaatgggacttagatggattcagtgagctggactctgagtcaggaagttcaagt
tctttttcagatgatgaagtctgggtgcaagtagcacctcagcgaaatgcacaggatcag
cagggttctttgtaa

DBGET integrated database retrieval system