KEGG   Homo sapiens (human): 84166
Entry
84166             CDS       T01001                                 
Symbol
NLRC5, CLR16.1, NOD27, NOD4
Name
(RefSeq) NLR family CARD domain containing 5
  KO
K22615  NLR family CARD domain containing 5
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:hsa04054]
    84166 (NLRC5)
Pattern recognition receptors [BR:hsa04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   84166 (NLRC5)
SSDB
Motif
Pfam: Atypical_Card NACHT LRR_6 LRR_4 NLRC4_HD2 LRR_8 AAA_16 NOD2_WH AAA AAA_22 nSTAND3 AAA_33 ABC_tran AAA_25 NB-ARC DnaB_C LAGLIDADG_2 RsgA_GTPase
Other DBs
NCBI-GeneID: 84166
NCBI-ProteinID: NP_115582
OMIM: 613537
HGNC: 29933
Ensembl: ENSG00000140853
UniProt: Q86WI3 Q6MZW3 Q9H6Y0
Position
16:56989557..57083520
AA seq 1866 aa
MDPVGLQLGNKNLWSCLVRLLTKDPEWLNAKMKFFLPNTDLDSRNETLDPEQRVILQLNK
LHVQGSDTWQSFIHCVCMQLEVPLDLEVLLLSTFGYDDGFTSQLGAEGKSQPESQLHHGL
KRPHQSCGSSPRRKQCKKQQLELAKKYLQLLRTSAQQRYRSQIPGSGQPHAFHQVYVPPI
LRRATASLDTPEGAIMGDVKVEDGADVSISDLFNTRVNKGPRVTVLLGKAGMGKTTLAHR
LCQKWAEGHLNCFQALFLFEFRQLNLITRFLTPSELLFDLYLSPESDHDTVFQYLEKNAD
QVLLIFDGLDEALQPMGPDGPGPVLTLFSHLCNGTLLPGCRVMATSRPGKLPACLPAEAA
MVHMLGFDGPRVEEYVNHFFSAQPSREGALVELQTNGRLRSLCAVPALCQVACLCLHHLL
PDHAPGQSVALLPNMTQLYMQMVLALSPPGHLPTSSLLDLGEVALRGLETGKVIFYAKDI
APPLIAFGATHSLLTSFCVCTGPGHQQTGYAFTHLSLQEFLAALHLMASPKVNKDTLTQY
VTLHSRWVQRTKARLGLSDHLPTFLAGLASCTCRPFLSHLAQGNEDCVGAKQAAVVQVLK
KLATRKLTGPKVVELCHCVDETQEPELASLTAQSLPYQLPFHNFPLTCTDLATLTNILEH
REAPIHLDFDGCPLEPHCPEALVGCGQIENLSFKSRKCGDAFAEALSRSLPTMGRLQMLG
LAGSKITARGISHLVKALPLCPQLKEVSFRDNQLSDQVVLNIVEVLPHLPRLRKLDLSSN
SICVSTLLCLARVAVTCPTVRMLQAREADLIFLLSPPTETTAELQRAPDLQESDGQRKGA
QSRSLTLRLQKCQLQVHDAEALIALLQEGPHLEEVDLSGNQLEDEGCRLMAEAASQLHIA
RKLDLSNNGLSVAGVHCVLRAVSACWTLAELHISLQHKTVIFMFAQEPEEQKGPQERAAF
LDSLMLQMPSELPLSSRRMRLTHCGLQEKHLEQLCKALGGSCHLGHLHLDFSGNALGDEG
AARLAQLLPGLGALQSLNLSENGLSLDAVLGLVRCFSTLQWLFRLDISFESQHILLRGDK
TSRDMWATGSLPDFPAAAKFLGFRQRCIPRSLCLSECPLEPPSLTRLCATLKDCPGPLEL
QLSCEFLSDQSLETLLDCLPQLPQLSLLQLSQTGLSPKSPFLLANTLSLCPRVKKVDLRS
LHHATLHFRSNEEEEGVCCGRFTGCSLSQEHVESLCWLLSKCKDLSQVDLSANLLGDSGL
RCLLECLPQVPISGLLDLSHNSISQESALYLLETLPSCPRVREASVNLGSEQSFRIHFSR
EDQAGKTLRLSECSFRPEHVSRLATGLSKSLQLTELTLTQCCLGQKQLAILLSLVGRPAG
LFSLRVQEPWADRARVLSLLEVCAQASGSVTEISISETQQQLCVQLEFPRQEENPEAVAL
RLAHCDLGAHHSLLVGQLMETCARLQQLSLSQVNLCEDDDASSLLLQSLLLSLSELKTFR
LTSSCVSTEGLAHLASGLGHCHHLEELDLSNNQFDEEGTKALMRALEGKWMLKRLDLSHL
LLNSSTLALLTHRLSQMTCLQSLRLNRNSIGDVGCCHLSEALRAATSLEELDLSHNQIGD
AGVQHLATILPGLPELRKIDLSGNSISSAGGVQLAESLVLCRRLEELMLGCNALGDPTAL
GLAQELPQHLRVLHLPFSHLGPGGALSLAQALDGSPHLEEISLAENNLAGGVLRFCMELP
LLRQIDLVSCKIDNQTAKLLTSSFTSCPALEVILLSWNLLGDEAAAELAQVLPQMGRLKR
VDLEKNQITALGAWLLAEGLAQGSSIQVIRLWNNPIPCDMAQHLKSQEPRLDFAFFDNQP
QAPWGT
NT seq 5601 nt   +upstreamnt  +downstreamnt
atggaccccgttggcctccagctcggcaacaagaacctgtggagctgtcttgtgaggctg
ctcaccaaagacccagaatggctgaacgccaagatgaagttcttcctccccaacacggac
ctggattccaggaacgagaccttggaccctgaacagagagtcatcctgcaactcaacaag
ctgcatgtccagggttcggacacctggcagtctttcattcattgtgtgtgcatgcagctg
gaggtgcctctggacctggaggtgctgctgctgagtacttttggctatgatgatgggttc
accagccagctgggagctgaggggaaaagccaacctgaatctcagctccaccatggcctg
aagcgcccacatcagagctgtgggtcctcaccccgccggaagcagtgcaagaagcagcag
ctagagttggccaagaagtacctgcagctcctgcggacctctgcccagcagcgctacagg
agccaaatccctgggtcagggcagccccacgccttccaccaggtctatgtccctccaatc
ctgcgccgggccacagcatccttagacactccggagggggccattatgggggacgtcaag
gtggaagatggtgctgacgtgagcatctcggacctcttcaacaccagggttaacaagggc
ccgagggtgaccgtgcttttggggaaggctggcatgggcaagaccacgctggcccaccgg
ctctgccagaagtgggcagagggccatctgaactgtttccaggccctgttcctttttgaa
ttccgccagctcaacttgatcacgaggttcctgacaccgtccgagctcctttttgatctg
tacctgagccctgaatcggaccacgacactgtcttccagtacctggagaagaacgctgac
caagtcctgctgatctttgatgggctagatgaggccctccagcctatgggtcctgatggc
ccaggcccagtcctcacccttttctcccatctctgcaatgggaccctcctgcctggctgc
cgggtgatggctacctcccgtccagggaagctgcctgcctgcctgcctgcagaggcagcc
atggtccacatgttgggctttgatgggccacgggtggaagaatatgtgaatcacttcttc
agcgcccagccatcgcgggagggggccctggtggagttacagacaaatggacgtctccga
agcctgtgtgcggtgcccgcactgtgccaagtcgcctgtctctgcctccaccatctgctt
cctgaccacgccccaggccagtctgtggccctcctgcccaacatgactcagctctatatg
cagatggtgctcgccctcagcccccctgggcacttgcccacctcgtccctactggacctg
ggggaggtggccctgaggggcctggagacagggaaggttatcttctatgcaaaagatatt
gctccacccttgatagcttttggggccactcacagcctgctgacttccttctgcgtctgc
acaggccctgggcaccagcagacaggctatgctttcacccacctcagcctgcaggagttt
cttgctgccctgcacctgatggccagccccaaggtgaacaaagacacacttacccagtat
gttaccctccattcccgctgggtacagcggaccaaagctagactgggcctctcagaccac
ctccccaccttcctggcgggcctggcatcctgcacctgccgccccttccttagccacctg
gcgcagggcaatgaggactgtgtgggtgccaagcaggctgctgtagtgcaggtgttgaag
aagttggccacccgcaagctcacagggccaaaggttgtagagctgtgtcactgtgtggat
gagacacaggagcctgagctggccagtctcaccgcacaaagcctcccctatcaactgccc
ttccacaatttcccactgacctgcaccgacctggccaccctgaccaacatcctagagcac
agggaggcccccatccacctggattttgatggctgtcccctggagccccactgccctgag
gctctggtaggctgtgggcagatagagaatctcagctttaagagcaggaagtgtggggat
gcctttgcagaagccctctccaggagcttgccgacaatggggaggctgcagatgctgggg
ttagcaggaagtaaaatcactgcccgaggcatcagccacctggtgaaagctttgcctctc
tgtccacagctgaaagaagtcagttttcgggacaaccagctcagtgaccaggtggtgctg
aacattgtggaggttctccctcacctaccacggctccggaagcttgacctgagcagcaac
agcatctgcgtgtcaaccctactctgcttggcaagggtggcagtcacgtgtcctaccgtc
aggatgcttcaggccagggaggcggacctcatcttccttctttccccgcccacagagaca
actgcagagctacaaagagctccagacctgcaggaaagtgacggccagaggaaaggggct
cagagcagaagcttgacgctcaggctgcagaagtgtcagctccaggtccacgatgcggag
gccctcatagccctgctccaggaaggccctcacctggaggaagtggacctctcagggaac
cagctggaagatgaaggctgtcggctgatggcagaggctgcatcccagctgcacatcgcc
aggaagctggacctcagtaacaacgggctttctgtggccggggtgcattgtgtgctgagg
gccgtgagtgcgtgctggaccctggcagagctgcacatcagcctgcagcacaaaactgtg
atcttcatgtttgcccaggagccagaggagcagaaggggccccaggagagggctgcattt
cttgacagcctcatgctccagatgccctctgagctgcctctgagctcccgaaggatgagg
ctgacacattgtggcctccaagaaaagcacctagagcagctctgcaaggctctgggagga
agctgccacctcggtcacctccacctcgacttctcaggcaatgctctgggggatgaaggt
gcagcccggctggctcagctgctcccagggctgggagctctgcagtccttgaacctcagt
gagaacggtttgtccctggatgccgtgttgggtttggttcggtgcttctccactctgcag
tggctcttccgcttggacatcagctttgaaagccaacacatcctcctgagaggggacaag
acaagcagggatatgtgggccactggatctttgccagacttcccagctgcagccaagttc
ttagggttccgtcagcgctgcatccccaggagcctctgcctcagtgagtgtcctctggag
cccccaagcctcacccgcctctgtgccactctgaaggactgcccgggacccctggaactg
caattgtcctgtgagttcctgagtgaccagagcctggagactctactggactgcttacct
caactccctcagctgagcctgctgcagctgagccagacgggactgtccccgaaaagcccc
ttcctgctggccaacaccttaagcctgtgtccacgggttaaaaaggtggatctcaggtcc
ctgcaccatgcaactttgcacttcagatccaacgaggaggaggaaggcgtgtgctgtggc
aggttcacaggctgcagcctcagccaggagcacgtagagtcactctgctggttgctgagc
aagtgtaaagacctcagccaggtggatctctcagcaaacctgctgggcgacagcggactc
agatgccttctggaatgtctgccgcaggtgcccatctccggtttgcttgatctgagtcac
aacagcatttctcaggaaagtgccctgtacctgctggagacactgccctcctgcccacgt
gtccgggaggcctcagtgaacctgggctctgagcagagcttccggattcacttctccaga
gaggaccaggctgggaagacactcaggctaagtgagtgcagcttccggccagagcacgtg
tccaggctggccaccggcttgagcaagtccctgcagctgacggagctcacgctgacccag
tgctgcctgggccagaagcagctggccatcctcctgagcttggtggggcgacccgcaggg
ctgttcagcctcagggtgcaggagccgtgggcggacagagccagggttctctccctgtta
gaagtctgcgcccaggcctcaggcagtgtcactgaaatcagcatctccgagacccagcag
cagctctgtgtccagctggaatttcctcgccaggaagagaatccagaagctgtggcactc
aggttggctcactgtgaccttggagcccaccacagccttcttgtcgggcagctgatggag
acatgtgccaggctgcagcagctcagcttgtctcaggttaacctctgtgaggacgatgat
gccagttccctgctgctgcagagcctcctgctgtccctctctgagctgaagacatttcgg
ctgacctccagctgtgtgagcaccgagggcctcgcccacctggcatctggtctgggccac
tgccaccacttggaggagctggacttgtctaacaatcaatttgatgaggagggcaccaag
gcgctgatgagggcccttgaggggaaatggatgctaaagaggctggacctcagtcacctt
ctgctgaacagctccaccttggccttgcttactcacagactaagccagatgacctgcctg
cagagcctcagactgaacaggaacagtatcggtgatgtcggttgctgccacctttctgag
gctctcagggctgccaccagcctagaggagctggacttgagccacaaccagattggagac
gctggtgtccagcacttagctaccatcctgcctgggctgccagagctcaggaagatagac
ctctcagggaatagcatcagctcagccgggggagtgcagttggcagagtctctcgttctt
tgcaggcgcctggaggagttgatgcttggctgcaatgccctgggggatcccacagccctg
gggctggctcaggagctgccccagcacctgagggtcctacacctaccattcagccatctg
ggcccaggtggggccctgagcctggcccaggccctggatggatccccccatttggaagag
atcagcttggcggaaaacaacctggctggaggggtcctgcgtttctgtatggagctcccg
ctgctcagacagatagacctggtttcctgtaagattgacaaccagactgccaagctcctc
acctccagcttcacgagctgccctgccctggaagtaatcttgctgtcctggaatctcctc
ggggatgaggcagctgccgagctggcccaggtgctgccgcagatgggccggctgaagaga
gtggacctggagaagaatcagatcacagctttgggggcctggctcctggctgaaggactg
gcccaggggtctagcatccaagtcatccgcctctggaataaccccattccctgcgacatg
gcccagcacctgaagagccaggagcccaggctggactttgccttctttgacaaccagccc
caggccccttggggtacttga

DBGET integrated database retrieval system