KEGG   Homo sapiens (human): 85235
Entry
85235             CDS       T01001                                 

Gene name
H2AC12, H2A/S, H2AFALii, H2AH, HIST1H2AH, dJ86C11.1
Definition
(RefSeq) H2A clustered histone 12
  KO
K11251  histone H2A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa04613  Neutrophil extracellular trap formation
hsa05034  Alcoholism
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    85235 (H2AC12)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    85235 (H2AC12)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    85235 (H2AC12)
  09165 Substance dependence
   05034 Alcoholism
    85235 (H2AC12)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    85235 (H2AC12)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    85235 (H2AC12)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    85235 (H2AC12)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   85235 (H2AC12)
SSDB
Motif
Pfam: Histone_H2A_C Histone CBFD_NFYB_HMF Ribosomal_L27A
Other DBs
NCBI-GeneID: 85235
NCBI-ProteinID: NP_542163
OMIM: 615013
HGNC: 13671
Ensembl: ENSG00000274997
Vega: OTTHUMG00000014468
Pharos: Q96KK5(Tdark)
UniProt: Q96KK5 A3KPC7
Position
6p22.1
AA seq 128 aa
MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK
TESHHKAK
NT seq 387 nt   +upstreamnt  +downstreamnt
atgtctggacgtggcaagcaaggcggtaaagctcgcgccaaggccaagacccgctcttct
cgggctgggcttcagttccccgtgggccgagtgcaccgcctgctccgcaagggtaattat
gccgagcgggttggagccggcgcgccagtgtacctggctgcggtgctggagtacctgacc
gctgagatcctggagctggctggcaatgcggcccgcgacaacaagaagacccgtatcatc
ccgcgtcacctccaactggccatccgcaacgacgaggagctcaacaagctgctgggcaaa
gtcaccatcgcgcagggtggtgtcttgcccaatatccaggccgtgctgctgcctaagaag
actgagagccaccataaggccaaataa

DBGET integrated database retrieval system