KEGG   Homo sapiens (human): 85508
Entry
85508             CDS       T01001                                 

Gene name
SCRT2, ZNF898B
Definition
(RefSeq) scratch family transcriptional repressor 2
  KO
K09219  scratch
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    85508 (SCRT2)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 Snail
    85508 (SCRT2)
SSDB
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-H2C2_2 zf-C2H2_6 zf-C2H2_jaz zf-met Zn-ribbon_8 zf-C2H2_11 zf-BED zf-Di19 HypA zinc_ribbon_15
Other DBs
NCBI-GeneID: 85508
NCBI-ProteinID: NP_149120
HGNC: 15952
Ensembl: ENSG00000215397
Vega: OTTHUMG00000130829
Pharos: Q9NQ03(Tdark)
UniProt: Q9NQ03
Position
20p13
AA seq 307 aa
MPRSFLVKKIKGDGFQCSGVPAPTYHPLETAYVLPGARGPPGDNGYAPHRLPPSSYDADQ
KPGLELAPAEPAYPPAAPEEYSDPESPQSSLSARYFRGEAAVTDSYSMDAFFISDGRSRR
RRGGGGGDAGGSGDAGGAGGRAGRAGAQAGGGHRHACAECGKTYATSSNLSRHKQTHRSL
DSQLARKCPTCGKAYVSMPALAMHLLTHNLRHKCGVCGKAFSRPWLLQGHMRSHTGEKPF
GCAHCGKAFADRSNLRAHMQTHSAFKHYRCRQCDKSFALKSYLHKHCEAACAKAAEPPPP
TPAGPAS
NT seq 924 nt   +upstreamnt  +downstreamnt
atgccgcgctccttcctggtaaagaagatcaaaggggacggcttccagtgcagcggggtg
ccggcccccacctaccaccccttggagacagcctacgtgctgcctggcgcccgggggcct
cccggggacaacgggtacgccccgcaccgcctgcccccgagcagctacgatgcggaccag
aagccgggcctggagctggccccggccgagcccgcgtacccgccggcggcgccggaggag
tacagcgaccccgaaagcccgcagtcgagcctgtcggcgcgctacttccgaggggaggcg
gcagtgaccgacagctactccatggacgccttcttcatctcggacgggcgctcgcggcgg
cggcggggcgggggcggcggggacgcggggggctcgggagacgcggggggcgccgggggg
cgcgcggggcgcgcgggggcgcaggcgggcggcgggcaccggcacgcgtgcgccgagtgc
ggcaagacctacgccacgtcgtcgaacctgagccgccacaagcagacgcaccgcagcctg
gacagccagctggcgcgcaaatgcccgacgtgcggcaaggcctacgtgtccatgcccgcg
ctcgccatgcacctgctcacgcacaacctgcgccacaagtgcggcgtctgcggcaaggcc
ttctcgcggccctggctgctgcagggtcacatgcgctcgcacaccggcgaaaagccgttc
ggctgcgcgcactgcggcaaggccttcgccgaccgctccaacctgcgcgcgcacatgcag
acgcactcggccttcaagcactaccgctgccgccagtgcgacaagagcttcgcgctcaag
tcctacctccacaagcactgcgaggcggcctgcgccaaggcggccgagccacccccgccg
acccccgccggcccggccagctga

DBGET integrated database retrieval system