KEGG   Homo sapiens (human): 87178Help
Entry
87178             CDS       T01001                                 

Gene name
PNPT1, COXPD13, DFNB70, OLD35, PNPASE, old-35
Definition
(RefSeq) polyribonucleotide nucleotidyltransferase 1
  KO
K00962  polyribonucleotide nucleotidyltransferase [EC:2.7.7.8]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03018  RNA degradation
Disease
H00891  Combined oxidative phosphorylation deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    87178 (PNPT1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    87178 (PNPT1)
   03016 Transfer RNA biogenesis [BR:hsa03016]
    87178 (PNPT1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.8  polyribonucleotide nucleotidyltransferase
     87178 (PNPT1)
Messenger RNA biogenesis [BR:hsa03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     87178 (PNPT1)
Transfer RNA biogenesis [BR:hsa03016]
 Prokaryotic Type
  tRNA degradation factors
   87178 (PNPT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNase_PH RNase_PH_C PNPase KH_1 S1
Motif
Other DBs
NCBI-GeneID: 87178
NCBI-ProteinID: NP_149100
OMIM: 610316
HGNC: 23166
Ensembl: ENSG00000138035
Vega: OTTHUMG00000129335
Pharos: Q8TCS8(Tbio)
UniProt: Q8TCS8
Structure
PDB: 

Position
2p16.1
AA seq 783 aa AA seqDB search
MAACRYCCSCLRLRPLSDGPFLLPRRDRALTQLQVRALWSSAGSRAVAVDLGNRKLEISS
GKLARFADGSAVVQSGDTAVMVTAVSKTKPSPSQFMPLVVDYRQKAAAAGRIPTNYLRRE
IGTSDKEILTSRIIDRSIRPLFPAGYFYDTQVLCNLLAVDGVNEPDVLAINGASVALSLS
DIPWNGPVGAVRIGIIDGEYVVNPTRKEMSSSTLNLVVAGAPKSQIVMLEASAENILQQD
FCHAIKVGVKYTQQIIQGIQQLVKETGVTKRTPQKLFTPSPEIVKYTHKLAMERLYAVFT
DYEHDKVSRDEAVNKIRLDTEEQLKEKFPEADPYEIIESFNVVAKEVFRSIVLNEYKRCD
GRDLTSLRNVSCEVDMFKTLHGSALFQRGQTQVLCTVTFDSLESGIKSDQVITAINGIKD
KNFMLHYEFPPYATNEIGKVTGLNRRELGHGALAEKALYPVIPRDFPFTIRVTSEVLESN
GSSSMASACGGSLALMDSGVPISSAVAGVAIGLVTKTDPEKGEIEDYRLLTDILGIEDYN
GDMDFKIAGTNKGITALQADIKLPGIPIKIVMEAIQQASVAKKEILQIMNKTISKPRASR
KENGPVVETVQVPLSKRAKFVGPGGYNLKKLQAETGVTISQVDEETFSVFAPTPSAMHEA
RDFITEICKDDQEQQLEFGAVYTATITEIRDTGVMVKLYPNMTAVLLHNTQLDQRKIKHP
TALGLEVGQEIQVKYFGRDPADGRMRLSRKVLQSPATTVVRTLNDRSSIVMGEPISQSSS
NSQ
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atggcggcctgcaggtactgctgctcgtgcctccggctccggcccctgagcgatggtcct
ttccttctgccacggcgggatcgggcactcacccagttgcaagtgcgagcactatggagt
agcgcagggtctcgagctgtggccgtggacttaggcaacaggaaattagaaatatcttct
ggaaagctggccagatttgcagatggctctgctgtagtacagtcaggtgacactgcagta
atggtcacagcggtcagtaaaacaaaaccttccccttcccagtttatgcctttggtggtt
gactacagacaaaaagctgctgcagcaggtagaattcccacaaactatctgagaagagag
attggtacttctgataaagaaattctaacaagtcgaataatagatcgttcaattagaccg
ctctttccagctggctacttctatgatacacaggttctgtgtaatctgttagcagtagat
ggtgtaaatgagcctgatgtcctagcaattaatggcgcttccgtagccctctcattatca
gatattccttggaatggacctgttggggcagtacgaataggaataattgatggagaatat
gttgttaacccaacaagaaaagaaatgtcttctagtactttaaatttagtggttgctgga
gcacctaaaagtcagattgtcatgttggaagcctctgcagagaacattttacagcaggac
ttttgccatgctatcaaagtgggagtgaaatatacccaacaaataattcagggcattcag
cagttggtaaaagaaactggtgttaccaagaggacacctcagaagttatttaccccttcg
ccagagattgtgaaatatactcataaacttgctatggagagactctatgcagtttttaca
gattacgagcatgacaaagtttccagagatgaagctgttaacaaaataagattagatacg
gaggaacaactaaaagaaaaatttccagaagccgatccatatgaaataatagaatccttc
aatgttgttgcaaaggaagtttttagaagtattgttttgaatgaatacaaaaggtgcgat
ggtcgggatttgacttcacttaggaatgtaagttgtgaggtagatatgtttaaaaccctt
catggatcagcattatttcaaagaggacaaacacaggtgctttgtaccgttacatttgat
tcattagaatctggtattaagtcagatcaagttataacagctataaatgggataaaagat
aaaaatttcatgctgcactacgagtttcctccttatgcaactaatgaaattggcaaagtc
actggtttaaatagaagagaacttgggcatggtgctcttgctgagaaagctttgtatcct
gttattccccgagattttcctttcaccataagagttacatctgaagtcctagagtcaaat
gggtcatcttctatggcatctgcatgtggcggaagtttagcattaatggattcaggggtt
ccaatttcatctgctgttgcaggcgtagcaataggattggtcaccaaaaccgatcctgag
aagggtgaaatagaagattatcgtttgctgacagatattttgggaattgaagattacaat
ggtgacatggacttcaaaatagctggcactaataaaggaataactgcattacaggctgat
attaaattacctggaataccaataaaaattgtgatggaggctattcaacaagcttcagtg
gcaaaaaaggagatattacagatcatgaacaaaactatttcaaaacctcgagcatctaga
aaagaaaatggacctgttgtagaaactgttcaggttccattatcaaaacgagcaaaattt
gttggacctggtggctataacttaaaaaaacttcaggctgaaacaggtgtaactattagt
caggtggatgaagaaacgttttctgtatttgcaccaacacccagtgctatgcatgaggca
agagacttcattactgaaatctgcaaggatgatcaggagcagcaattagaatttggagca
gtatataccgccacaataactgaaatcagagatactggtgtaatggtaaaattatatcca
aatatgactgcggtactgcttcataacacacaacttgatcaacgaaagattaaacatcct
actgccctaggattagaagttggccaagaaattcaggtgaaatactttggacgtgaccca
gccgatggaagaatgaggctttctcgaaaagtgcttcagtcgccagctacaaccgtggtc
agaactttgaatgacagaagtagtattgtaatgggagaacctatttcacagtcatcatct
aattctcagtga

DBGET integrated database retrieval system