KEGG   Homo sapiens (human): 883Help
Entry
883               CDS       T01001                                 

Gene name
KYAT1, CCBL1, GTK, KAT1, KATI
Definition
(RefSeq) kynurenine aminotransferase 1
  KO
K00816  kynurenine---oxoglutarate transaminase / cysteine-S-conjugate beta-lyase / glutamine---phenylpyruvate transaminase [EC:2.6.1.7 4.4.1.13 2.6.1.64]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00270  Cysteine and methionine metabolism
hsa00380  Tryptophan metabolism
hsa00450  Selenocompound metabolism
hsa01100  Metabolic pathways
hsa05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    883 (KYAT1)
   00380 Tryptophan metabolism
    883 (KYAT1)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    883 (KYAT1)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    883 (KYAT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hsa01007]
    883 (KYAT1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.7  kynurenine---oxoglutarate transaminase
     883 (KYAT1)
    2.6.1.64  glutamine---phenylpyruvate transaminase
     883 (KYAT1)
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.13  cysteine-S-conjugate beta-lyase
     883 (KYAT1)
Amino acid related enzymes [BR:hsa01007]
 Aminotransferase (transaminase)
  Class I
   883 (KYAT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2 Cys_Met_Meta_PP DegT_DnrJ_EryC1 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 883
NCBI-ProteinID: NP_001116143
OMIM: 600547
HGNC: 1564
Ensembl: ENSG00000171097 ENSG00000286112
Vega: OTTHUMG00000020767
Pharos: Q16773(Tbio)
UniProt: Q16773 A8K563
Structure
PDB: 

Position
9q34.11
AA seq 422 aa AA seqDB search
MAKQLQARRLDGIDYNPWVEFVKLASEHDVVNLGQGFPDFPPPDFAVEAFQHAVSGDFML
NQYTKTFGYPPLTKILASFFGELLGQEIDPLRNVLVTVGGYGALFTAFQALVDEGDEVII
IEPFFDCYEPMTMMAGGRPVFVSLKPGPIQNGELGSSSNWQLDPMELAGKFTSRTKALVL
NTPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQWMVYDGHQHISIASLPGMWERTL
TIGSAGKTFSATGWKVGWVLGPDHIMKHLRTVHQNSVFHCPTQSQAAVAESFEREQLLFR
QPSSYFVQFPQAMQRCRDHMIRSLQSVGLKPIIPQGSYFLITDISDFKRKMPDLPGAVDE
PYDRRFVKWMIKNKGLVAIPVSIFYSVPHQKHFDHYIRFCFVKDEATLQAMDEKLRKWKV
EL
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggccaaacagctgcaggcccgaaggctagacgggatcgactacaacccctgggtggag
tttgtgaaactggccagtgagcatgacgtcgtgaacttgggccagggcttcccggatttc
ccaccaccagactttgccgtggaagcctttcagcacgctgtcagtggagacttcatgctt
aaccagtacaccaagacatttggttacccaccactgacgaagatcctggcaagtttcttt
ggggagctgctgggtcaggagatagacccgctcaggaatgtgctggtgactgttggtggc
tatggggccctgttcacagccttccaggccctggtggacgaaggagacgaggtcatcatc
atcgaacccttttttgactgctacgagcccatgacaatgatggcagggggtcgtcctgtg
tttgtgtccctgaagccgggtcccatccagaatggagaactgggttccagcagcaactgg
cagctggaccccatggagctggccggcaaattcacatcacgcaccaaagccctggtcctc
aacacccccaacaaccccctgggcaaggtgttctccagggaagagctggagctggtggcc
agcctttgccagcagcatgacgtggtgtgtatcactgatgaagtctaccagtggatggtc
tacgacgggcaccagcacatcagcattgccagcctccctggcatgtgggaacggaccctg
accatcggcagcgccggcaagaccttcagcgccactggctggaaggtgggctgggtcctg
ggtccagatcacatcatgaagcacctgcggaccgtgcaccagaactccgtcttccactgc
cccacgcagagccaggctgcagtagccgagagctttgaacgggagcagctgctcttccgc
caacccagcagctactttgtgcagttcccgcaggccatgcagcgctgccgtgaccacatg
atacgtagcctacagtcagtgggcctgaagcccatcatccctcagggcagctacttcctc
atcacagacatctcagacttcaagaggaagatgcctgacttgcctggagctgtggatgag
ccctatgacagacgcttcgtcaagtggatgatcaagaacaagggcttggtggccatccct
gtctccatcttctatagtgtgccacatcagaagcactttgaccactatatccgcttctgt
tttgtgaaggatgaagccacgctccaggccatggacgagaagctgcggaagtggaaggtg
gaactctag

DBGET integrated database retrieval system