KEGG   Homo sapiens (human): 88455Help
Entry
88455             CDS       T01001                                 

Gene name
ANKRD13A, ANKRD13, NY-REN-25
Definition
(RefSeq) ankyrin repeat domain 13A
  KO
K21437  ankyrin repeat domain-containing protein 13
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    88455 (ANKRD13A)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Others
    88455 (ANKRD13A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GPCR_chapero_1 Ank_4 Ank_2 Ank_3 Ank_5 Ank UIM
Motif
Other DBs
NCBI-GeneID: 88455
NCBI-ProteinID: NP_149112
OMIM: 615123
HGNC: 21268
Ensembl: ENSG00000076513
Vega: OTTHUMG00000169314
Pharos: Q8IZ07(Tdark)
UniProt: Q8IZ07 Q3ZTS7 Q9Y5A3
Position
12q24.11
AA seq 590 aa AA seqDB search
MSSACDAGDHYPLHLLVWKNDYRQLEKELQGQNVEAVDPRGRTLLHLAVSLGHLESARVL
LRHKADVTKENRQGWTVLHEAVSTGDPEMVYTVLQHRDYHNTSMALEGVPELLQKILEAP
DFYVQMKWEFTSWVPLVSRICPNDVCRIWKSGAKLRVDITLLGFENMSWIRGRRSFIFKG
EDNWAELMEVNHDDKVVTTERFDLSQEMERLTLDLMKPKSREVERRLTSPVINTSLDTKN
IAFERTKSGFWGWRTDKAEVVNGYEAKVYTVNNVNVITKIRTEHLTEEEKKRYKADRNPL
ESLLGTVEHQFGAQGDLTTECATANNPTAITPDEYFNEEFDLKDRDIGRPKELTIRTQKF
KAMLWMCEEFPLSLVEQVIPIIDLMARTSAHFARLRDFIKLEFPPGFPVKIEIPLFHVLN
ARITFGNVNGCSTAEESVSQNVEGTQADSASHITNFEVDQSVFEIPESYYVQDNGRNVHL
QDEDYEIMQFAIQQSLLESSRSQELSGPASNGGISQTNTYDAQYERAIQESLLTSTEGLC
PSALSETSRFDNDLQLAMELSAKELEEWELRLQEEEAELQQVLQLSLTDK
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcggcctgcgacgcgggcgaccactaccccctgcacctcctagtctggaaaaac
gactaccggcagctcgagaaggagctgcagggccagaatgtggaggctgtggacccacga
ggtcgaacattattgcatcttgctgtttccttgggacatttggaatctgctcgagtctta
ctccgacataaagcagatgtgacaaaagaaaatcgccagggatggacagttttacatgag
gctgtgagcactggcgatcctgagatggtgtacacagttctccaacatcgagactaccac
aacacatccatggcccttgagggagttcctgagctgctccaaaaaattctcgaggctccg
gatttctatgtgcagatgaaatgggaattcaccagctgggtgcccttggtttctagaata
tgcccaaatgatgtctgtcgcatctggaaaagtggtgccaaactgcgcgtcgatatcaca
ttgctgggatttgaaaacatgagctggataagagggaggcgtagttttatatttaaggga
gaagacaactgggcggagttaatggaagtcaaccatgatgacaaagtggtcaccaccgaa
cgcttcgacctttcccaagaaatggagcgcctcactctggacttgatgaagccaaaaagc
agggaagttgagcggcggctcacaagccctgtcattaacaccagcctcgatactaaaaat
attgcttttgaaagaactaaatccggattctggggctggaggacagataaagcagaagtt
gttaatggttacgaagcaaaggtttacacagtaaacaatgtgaatgtgatcaccaaaata
cgcacagaacatctgaccgaggaggaaaaaaagagatataaagcagacaggaacccgctg
gaatctttgctgggaactgtggaacaccaatttggtgcacaaggggacctcaccacggaa
tgtgctactgcaaacaaccccacagccatcacgcctgatgagtacttcaatgaagagttt
gatctgaaagacagggacattggaaggccgaaagagctgacgattagaacacagaagttt
aaagcaatgttgtggatgtgtgaagagtttcccctctctctggtggagcaggtcattccc
atcattgacctaatggctcgaacgagtgctcattttgcaagactgagagatttcatcaaa
ttggaattcccacctggatttcctgtcaaaatagaaattcccttgtttcatgtcttaaat
gcacggattacatttggaaatgttaatggctgtagcactgccgaagaatctgtatctcaa
aatgtggaagggacccaggctgattcagcttcccacatcacaaactttgaggttgatcaa
tctgtgtttgaaattcccgaatcttactatgttcaagacaatggcagaaatgtgcatttg
caagatgaagattacgagataatgcagtttgccatccagcaaagtctgctggagtccagc
aggagccaggaactttcaggaccagcttcgaatggagggatcagccagacaaacacctat
gacgcccagtatgagagggccatccaggagagcctcctcaccagcacagaaggcctgtgc
cccagcgccctgagcgagacaagccgttttgataatgacttgcagctagccatggagctc
tctgccaaagagctggaggaatgggagctccggctccaggaggaagaggctgagctccag
caagtcttacagctgtcactcactgacaaatag

DBGET integrated database retrieval system