KEGG   Homo sapiens (human): 8879Help
Entry
8879              CDS       T01001                                 

Gene name
SGPL1, NPHS14, S1PL, SPL
Definition
(RefSeq) sphingosine-1-phosphate lyase 1
  KO
K01634  sphinganine-1-phosphate aldolase [EC:4.1.2.27]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00600  Sphingolipid metabolism
hsa01100  Metabolic pathways
hsa04071  Sphingolipid signaling pathway
Module
hsa_M00100  Sphingosine degradation
Disease
H01657  Nephrotic syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    8879 (SGPL1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    8879 (SGPL1)
Enzymes [BR:hsa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.27  sphinganine-1-phosphate aldolase
     8879 (SGPL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Aminotran_1_2 SepSecS DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-GeneID: 8879
NCBI-ProteinID: NP_003892
OMIM: 603729
HGNC: 10817
Ensembl: ENSG00000166224
Vega: OTTHUMG00000018421
Pharos: O95470(Tchem)
UniProt: O95470
Structure
PDB: 

Position
10q22.1
AA seq 568 aa AA seqDB search
MPSTDLLMLKAFEPYLEILEVYSTKAKNYVNGHCTKYEPWQLIAWSVVWTLLIVWGYEFV
FQPESLWSRFKKKCFKLTRKMPIIGRKIQDKLNKTKDDISKNMSFLKVDKEYVKALPSQG
LSSSAVLEKLKEYSSMDAFWQEGRASGTVYSGEEKLTELLVKAYGDFAWSNPLHPDIFPG
LRKIEAEIVRIACSLFNGGPDSCGCVTSGGTESILMACKAYRDLAFEKGIKTPEIVAPQS
AHAAFNKAASYFGMKIVRVPLTKMMEVDVRAMRRAISRNTAMLVCSTPQFPHGVIDPVPE
VAKLAVKYKIPLHVDACLGGFLIVFMEKAGYPLEHPFDFRVKGVTSISADTHKYGYAPKG
SSLVLYSDKKYRNYQFFVDTDWQGGIYASPTIAGSRPGGISAACWAALMHFGENGYVEAT
KQIIKTARFLKSELENIKGIFVFGNPQLSVIALGSRDFDIYRLSNLMTAKGWNLNQLQFP
PSIHFCITLLHARKRVAIQFLKDIRESVTQIMKNPKAKTTGMGAIYGMAQTTVDRNMVAE
LSSVFLDSLYSTDTVTQGSQMNGSPKPH
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgcctagcacagaccttctgatgttgaaggcctttgagccctacttagagattttggaa
gtatactccacaaaagccaagaattatgtaaatggacattgcaccaagtatgagccctgg
cagctaattgcatggagtgtcgtgtggaccctgctgatagtctggggatatgagtttgtc
ttccagccagagagtttatggtcaaggtttaaaaagaaatgttttaagctcaccaggaag
atgcccattattggtcgtaagattcaagacaagttgaacaagaccaaggatgatattagc
aagaacatgtcattcctgaaagtggacaaagagtatgtgaaagctttaccctcccagggt
ctgagctcatctgctgttttggagaaacttaaggagtacagctctatggacgccttctgg
caagaggggagagcctctggaacagtgtacagtggggaggagaagctcactgagctcctt
gtgaaggcttatggagattttgcatggagtaaccccctgcatccagatatcttcccagga
ctacgcaagatagaggcagaaatcgtgaggatagcttgttccctgttcaatgggggacca
gattcgtgtggatgtgtgacttctgggggaacagaaagcatactgatggcctgcaaagca
tatcgggatctggcctttgagaaggggatcaaaactccagaaattgtggctccccaaagt
gcccatgctgcatttaacaaagcagccagttactttgggatgaagattgtgcgggtccca
ttgacgaagatgatggaggtggatgtgcgggcaatgagaagagctatctccaggaacact
gccatgctcgtctgttctaccccacagtttcctcatggtgtaatagatcctgtccctgaa
gtggccaagctggctgtcaaatacaaaataccccttcatgtcgacgcttgtctgggaggc
ttcctcatcgtctttatggagaaagcaggatacccactggagcacccatttgatttccgg
gtgaaaggtgtaaccagcatttcagctgacacccataagtatggctatgccccaaaaggc
tcatcattggtgttgtatagtgacaagaagtacaggaactatcagttcttcgtcgataca
gattggcagggtggcatctatgcttccccaaccatcgcaggctcacggcctggtggcatt
agcgcagcctgttgggctgccttgatgcacttcggtgagaacggctatgttgaagctacc
aaacagatcatcaaaactgctcgcttcctcaagtcagaactggaaaatatcaaaggcatc
tttgtttttgggaatccccaattgtcagtcattgctctgggatcccgtgattttgacatc
taccgactatcaaacctgatgactgctaaggggtggaacttgaaccagttgcagttccca
cccagtattcatttctgcatcacattactacacgcccggaaacgagtagctatacaattc
ctaaaggacattcgagaatctgtcactcaaatcatgaagaatcctaaagcgaagaccaca
ggaatgggtgccatctatggcatggcccagacaactgttgacaggaatatggttgcagaa
ttgtcctcagtcttcttggacagcttgtacagcaccgacactgtcacccagggcagccag
atgaatggttctccaaaaccccactga

DBGET integrated database retrieval system