KEGG   Homo sapiens (human): 8935Help
Entry
8935              CDS       T01001                                 

Gene name
SKAP2, PRAP, RA70, SAPS, SCAP2, SKAP-HOM, SKAP55R
Definition
(RefSeq) src kinase associated phosphoprotein 2
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: PH SH3_1 SH3_9 SH3_2 PH_11 PH_9 PH_13 PH_8
Motif
Other DBs
NCBI-GeneID: 8935
NCBI-ProteinID: NP_003921
OMIM: 605215
HGNC: 15687
Ensembl: ENSG00000005020
Vega: OTTHUMG00000023495
Pharos: O75563(Tbio)
UniProt: O75563
Position
7p15.2
AA seq 359 aa AA seqDB search
MPNPSSTSSPYPLPEEIRNLLADVETFVADILKGENLSKKAKEKRESLIKKIKDVKSIYL
QEFQDKGDAEDGEEYDDPFAGPPDTISLASERYDKDDEAPSDGAQFPPIAAQDLPFVLKA
GYLEKRRKDHSFLGFEWQKRWCALSKTVFYYYGSDKDKQQKGEFAIDGYSVRMNNTLRKD
GKKDCCFEISAPDKRIYQFTAASPKDAEEWVQQLKFVLQDMESDIIPEDYDERGELYDDV
DHPLPISNPLTSSQPIDDEIYEELPEEEEDSAPVKVEEQRKMSQDSVHHTSGDKSTDYAN
FYQGLWDCTGAFSDELSFKRGDVIYILSKEYNRYGWWVGEMKGAIGLVPKAYIMEMYDI
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaccccagcagcacctcctctccctaccccctccctgaggaaattaggaacctg
ttggcagatgttgaaacatttgtagcagatatactgaaaggagaaaatttatccaagaaa
gcaaaggaaaagagagaatcccttattaagaagataaaagatgtaaagtctatctatctt
caggaatttcaagacaaaggtgatgcagaagatggggaagaatatgatgacccttttgct
gggcctccagacactatttcattagcctcagaacgatatgataaagacgatgaagccccc
tctgatggagcccagtttcctccaattgcagcacaagaccttccttttgttctaaaggct
ggctaccttgaaaaacgcagaaaagatcacagctttctgggatttgaatggcagaaacgg
tggtgtgctctcagtaaaacggtattctattattatggaagtgataaagacaaacaacag
aaaggtgaatttgcaatagatggctacagtgtcagaatgaataacactctaagaaaggat
ggaaagaaagattgctgttttgaaatctctgctcctgataaacgtatatatcagtttaca
gcagcttctcccaaagatgctgaagaatgggtacagcagctgaaatttgtattgcaagat
atggaatctgatattattcctgaggattatgatgagagaggagaattatatgatgatgtt
gatcatcctctaccaataagcaatccactaacaagcagtcaaccaatagatgatgaaatt
tatgaagaacttccagaagaagaagaggacagtgctccagtgaaagtggaagaacaaagg
aagatgagtcaggatagtgtccatcacacctcaggggataagagcactgattatgctaat
ttttaccagggattgtgggattgtactggagctttttctgatgagttgtcatttaagcgt
ggtgatgtgatttacattcttagcaaggaatacaatagatatggctggtgggtaggagaa
atgaagggagccattggcttggtgcctaaagcctacataatggagatgtatgatatttga

DBGET integrated database retrieval system