KEGG   Homo sapiens (human): 896Help
Entry
896               CDS       T01001                                 

Gene name
CCND3
Definition
(RefSeq) cyclin D3
  KO
K10152  G1/S-specific cyclin-D3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04115  p53 signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04218  Cellular senescence
hsa04310  Wnt signaling pathway
hsa04390  Hippo signaling pathway
hsa04510  Focal adhesion
hsa04630  Jak-STAT signaling pathway
hsa05162  Measles
hsa05165  Human papillomavirus infection
hsa05166  HTLV-I infection
hsa05200  Pathways in cancer
hsa05203  Viral carcinogenesis
Module
hsa_M00692  Cell cycle - G1/S transition
Network
N00066  MDM2-p21-Cell cycle G1/S
N00067  Deleted p14(ARF) to p21-cell cycle G1/S
N00068  Amplified MDM2 to p21-cell cycle G1/S
N00069  p16-Cell cycle G1/S
N00070  Mutation-inactivated p16(INK4a) to p16-cell cycle G1/S
N00071  Deleted p16(INK4a) to p16-cell cycle G1/S
N00072  Amplified CDK4 to cell cycle G1/S
N00073  Mutation-activated CDK4 to cell cycle G1/S
N00076  Mutation-inactivated p14(ARF) to p21-cell cycle G1/S
N00088  Amplified MYC to p15-cell cycle G1/S
N00089  Amplified MYC to cell cycle G1/S
N00090  p15-Cell cycle G1/S
N00221  HTLV-I Tax to host-cell-protein activation
N00263  EBV EBNA3C to host-cell-protein activation
Disease
H00010  Multiple myeloma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    896 (CCND3)
   04390 Hippo signaling pathway
    896 (CCND3)
   04630 Jak-STAT signaling pathway
    896 (CCND3)
   04151 PI3K-Akt signaling pathway
    896 (CCND3)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    896 (CCND3)
   04115 p53 signaling pathway
    896 (CCND3)
   04218 Cellular senescence
    896 (CCND3)
  Cellular community - eukaryotes
   04510 Focal adhesion
    896 (CCND3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    896 (CCND3)
   05203 Viral carcinogenesis
    896 (CCND3)
  Infectious diseases
   05166 HTLV-I infection
    896 (CCND3)
   05162 Measles
    896 (CCND3)
   05165 Human papillomavirus infection
    896 (CCND3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C
Motif
Other DBs
NCBI-GeneID: 896
NCBI-ProteinID: NP_001751
OMIM: 123834
HGNC: 1585
Ensembl: ENSG00000112576
Vega: OTTHUMG00000014690
Pharos: P30281(Tchem)
UniProt: P30281
Structure
PDB: 

Position
6p21.1
AA seq 292 aa AA seqDB search
MELLCCEGTRHAPRAGPDPRLLGDQRVLQSLLRLEERYVPRASYFQCVQREIKPHMRKML
AYWMLEVCEEQRCEEEVFPLAMNYLDRYLSCVPTRKAQLQLLGAVCMLLASKLRETTPLT
IEKLCIYTDHAVSPRQLRDWEVLVLGKLKWDLAAVIAHDFLAFILHRLSLPRDRQALVKK
HAQTFLALCATDYTFAMYPPSMIATGSIGAAVQGLGACSMSGDELTELLAGITGTEVDCL
RACQEQIEAALRESLREASQTSSSPAPKAPRGSSSQGPSQTSTPTDVTAIHL
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atggagctgctgtgttgcgaaggcacccggcacgcgccccgggccgggccggacccgcgg
ctgctgggggaccagcgtgtcctgcagagcctgctccgcctggaggagcgctacgtaccc
cgcgcctcctacttccagtgcgtgcagcgggagatcaagccgcacatgcggaagatgctg
gcttactggatgctggaggtatgtgaggagcagcgctgtgaggaggaagtcttccccctg
gccatgaactacctggatcgctacctgtcttgcgtccccacccgaaaggcgcagttgcag
ctcctgggtgcggtctgcatgctgctggcctccaagctgcgcgagaccacgcccctgacc
atcgaaaaactgtgcatctacaccgaccacgctgtctctccccgccagttgcgggactgg
gaggtgctggtcctagggaagctcaagtgggacctggctgctgtgattgcacatgatttc
ctggccttcattctgcaccggctctctctgccccgtgaccgacaggccttggtcaaaaag
catgcccagacctttttggccctctgtgctacagattatacctttgccatgtacccgcca
tccatgatcgccacgggcagcattggggctgcagtgcaaggcctgggtgcctgctccatg
tccggggatgagctcacagagctgctggcagggatcactggcactgaagtggactgcctg
cgggcctgtcaggagcagatcgaagctgcactcagggagagcctcagggaagcctctcag
accagctccagcccagcgcccaaagccccccggggctccagcagccaagggcccagccag
accagcactcctacagatgtcacagccatacacctgtag

DBGET integrated database retrieval system