KEGG   Homo sapiens (human): 90187
Entry
90187             CDS       T01001                                 

Gene name
EMILIN3, C20orf130, EMILIN5, dJ620E11.4
Definition
(RefSeq) elastin microfibril interfacer 3
  KO
K24246   
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: EMI DUF1664 Baculo_PEP_C Spc7 BicD Golgin_A5 ATG16 His_Phos_1 SlyX Yuri_gagarin DUF3450 CorA EzrA COG2 Fez1 AAA_13 Filament TACC_C Lebercilin GSH_synth_ATP DUF16 Rootletin
Other DBs
NCBI-GeneID: 90187
NCBI-ProteinID: NP_443078
OMIM: 608929
HGNC: 16123
Ensembl: ENSG00000183798
Vega: OTTHUMG00000046304
Pharos: Q9NT22(Tdark)
UniProt: Q9NT22
Position
20q12
AA seq 766 aa
MGRRRLLVWLCAVAALLSGAQARGTPLLARPAPPGASRYSLYTTGWRPRLRPGPHKALCA
YVVHRNVTCILQEGAESYVKAEYRQCRWGPKCPGTVTYRTVLRPKYKVGYKTVTDLAWRC
CPGFTGKRCPEHLTDHGAASPQLEPEPQIPSGQLDPGPRPPSYSRAAPSPHGRKGPGLFG
ERLERLEGDVQRLAQTYGTLSGLVASHEDPNRMTGGPRAPAVPVGFGVIPEGLVGPGDRA
RGPLTPPLDEILSKVTEVSNTLQTKVQLLDKVHGLALGHEAHLQRLREAPPSPLTSLALL
EEYVDRRLHRLWGSLLDGFEQKLQGVQSECDLRVQEVRRQCEEGQAASRRLHQSLDGREL
ALRQELSQLGSQLQGLSVSGRGSCCGQLALINARMDGLERALQAVTETQRGPGAPAGDEL
TRLSAAMLEGGVDGLLEGLETLNGTEGGARGCCLRLDMGGWGVGGFGTMLEERVQSLEER
LATLAGELSHDSASPGRSARPLVQTELAVLEQRLVSLETSCTPSTTSAILDSLVAEVKAW
QSRSEALLRQVASHAALLQQLNGTVAEVQGQLAEGTGSSLQGEITLLKVNLNSVSKSLTG
LSDSVSQYSDAFLAANTSLDERERKVEAEVQAIQEQVSSQGSRLQAGHRQVLNLRGELEQ
LKAGVAKVASGLSRCQDTAQKLQHTVGHFDQRVAQVEGACRRLGLLAAGLDSLPTEPLRP
REGLWSHVDQLNRTLAQHTQDIARLRDDLLDCQAQLAEQVRPGQAN
NT seq 2301 nt   +upstreamnt  +downstreamnt
atgggccgccgccgcctgctcgtctggctgtgcgccgtcgcggcgctgctctcgggggcg
caggccaggggcaccccgctcctggcgcggcctgcgccgcccggtgcctcccgctacagt
ctctacacgacgggatggcgcccgcggctgcgcccggggccgcacaaggccctctgtgcc
tatgtggtgcacaggaatgtgacctgcatcctacaggagggagcggagagctacgtaaag
gctgaataccggcagtgtagatgggggcccaagtgccccgggacagtcacgtaccgcaca
gtactcagacccaaatacaaggttggctacaagacagtgacagacctcgcctggcgttgc
tgtcccggcttcactgggaaacgctgccctgagcacctcacggaccatggggctgcctca
ccccagctggagcctgagcctcagattccttcagggcagctggacccaggccccaggccc
ccttcctacagcagagcagcccccagccctcatggaaggaaaggcccagggctgtttggt
gagcggctggaacgcctggagggtgatgtccagcgcctggctcaaacatatggtaccctc
agtggcctggtggctagccacgaggatcccaacaggatgactggtggccccagggctcct
gctgtccctgtgggctttggggtcatccctgaggggcttgtgggcccaggagacagagcc
agagggccactaacacctcccttagacgagatcctaagcaaggtgacagaggtgagcaac
actcttcagaccaaggtgcagcttctagacaaggtgcatgggctggcacttggccatgag
gcccacctgcagcggctgcgggaagccccaccatccccgctcacctccctggccctgctg
gaggagtacgtggaccgacggctgcaccgactctgggggagcctgctggatggctttgag
cagaagctgcaaggcgtccagagtgagtgtgacctgcgggtgcaggaggtacggcggcaa
tgtgaggagggtcaggccgccagccggaggctgcaccagagccttgatggccgggagctg
gccctgcgccaggagctgtcacagctgggcagccagctgcagggcctgagcgtgtctggc
aggggcagctgctgtgggcaactagccttgatcaatgcccgtatggatggccttgagagg
gccctgcaggcagtcaccgagacccaaaggggccccggtgccccggccggggatgagctt
acgaggctctctgctgccatgctcgagggaggtgtggacgggctgcttgagggtctggag
acgctcaatgggacagagggtggagcaaggggatgctgtctgaggttggacatggggggg
tggggagtgggcggctttgggaccatgctggaagagcgcgtgcagagcctcgaggagcgc
ctagcaacattggctggggagctaagccatgacagcgcctctccgggcaggtcagctcgg
ccccttgtacagacagagctggctgtgctagagcaacggttggtctcactggagacttcg
tgcaccccgagcaccacctcagccatcctggacagcctcgtggcagaggtgaaggcctgg
cagagccggagcgaggccctcctacgccaggtggccagccacgcagcactgctccagcag
ctcaatggcactgtggccgaggtccagggacagctggcagaagggacgggcagctcactt
caaggcgagatcactctgctcaaggtcaatctgaactcagtgagcaagtcgctcacaggc
ctcagtgactctgtcagccagtactctgatgccttcttggctgccaacacgtccctggat
gagcgggaacgcaaggtggaagccgaagtccaggccatccaggagcaggtcagcagccaa
ggctccaggcttcaggctggccacaggcaggtcctgaacctgcgtggggagctggagcaa
ctcaaggctggtgtggccaaggtggccagtgggctgagccgctgccaggacacagcccag
aaacttcagcacacagtgggacactttgaccagcgggtggcacaagtggagggtgcgtgc
aggaggctgggcctgctggccgcgggcctggacagcttgcccactgagccactgaggccc
agagagggcctgtggagccatgtggaccagctgaatcgtacgctggcccagcacacgcag
gacattgcccgcctccgggatgacctactggactgccaggcccagctggctgagcaggtg
cggccagggcaagccaactag

DBGET integrated database retrieval system