KEGG   Homo sapiens (human): 90293
Entry
90293             CDS       T01001                                 
Symbol
KLHL13, BKLHD2, KIAA1309
Name
(RefSeq) kelch like family member 13
  KO
K10447  kelch-like protein 9/13
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    90293 (KLHL13)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    90293 (KLHL13)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     90293 (KLHL13)
SSDB
Motif
Pfam: Kelch_1 Kelch_6 BACK Kelch_3 BTB Kelch_2 Kelch_4 Kelch_5
Other DBs
NCBI-GeneID: 90293
NCBI-ProteinID: NP_277030
OMIM: 300655
HGNC: 22931
Ensembl: ENSG00000003096
Pharos: Q9P2N7(Tdark)
UniProt: Q9P2N7 Q96HC9
Position
X:complement(117897813..118131050)
AA seq 655 aa
MPLKWKTSSPAIWKFPVPVLKTSRSTPLSPAYISLVEEEDQHMKLSLGGSEMGLSSHLQS
SKAGPTRIFTSNTHSSVVLQGFDQLRLEGLLCDVTLMPGDTDDAFPVHRVMMASASDYFK
AMFTGGMKEQDLMCIKLHGVSKVGLRKIIDFIYTAKLSLNMDNLQDTLEAASFLQILPVL
DFCKVFLISGVTLDNCVEVGRIANTYNLTEVDKYVNSFVLKNFPALLSTGEFLKLPFERL
AFVLSSNSLKHCTELELFKATCRWLRLEEPRMDFAAKLMKNIRFPLMTPQELINYVQTVD
FMRTDNTCVNLLLEASNYQMMPYMQPVMQSDRTAIRSDTTHLVTLGGVLRQQLVVSKELR
MYDEKAHEWKSLAPMDAPRYQHGIAVIGNFLYVVGGQSNYDTKGKTAVDTVFRFDPRYNK
WMQVASLNEKRTFFHLSALKGYLYAVGGRNAAGELPTVECYNPRTNEWTYVAKMSEPHYG
HAGTVYGGVMYISGGITHDTFQKELMCFDPDTDKWIQKAPMTTVRGLHCMCTVGERLYVI
GGNHFRGTSDYDDVLSCEYYSPILDQWTPIAAMLRGQSDVGVAVFENKIYVVGGYSWNNR
CMVEIVQKYDPDKDEWHKVFDLPESLGGIRACTLTVFPPEETTPSPSRESPLSAP
NT seq 1968 nt   +upstreamnt  +downstreamnt
atgccattgaaatggaaaacgagctctcctgctatctggaaattcccagttcctgtgctt
aaaacatccaggtcaactccactttctccagcatacatatctctcgtggaagaggaagac
caacacatgaaattgtcccttggaggcagcgaaatgggcctctcatcccatttgcagtct
tccaaggcaggacctacacgcatctttaccagcaatacccacagttctgtggtgttacag
ggctttgaccagcttcgacttgaaggattgctttgtgatgtgaccctgatgccaggtgac
acagatgatgctttccctgtgcatagagtcatgatggcatctgctagtgattacttcaag
gctatgttcacaggtggaatgaaagaacaagatttaatgtgcattaaacttcatggtgtg
agcaaagtcggtctaaggaaaattattgatttcatttatactgcaaagctttctcttaat
atggacaaccttcaagacacgctggaagctgccagtttcctacagattctgccagttttg
gacttctgtaaagtgtttctcatatctggggtcactttagacaactgtgttgaagttgga
cggattgccaacacctacaatctaaccgaagtggataaatacgttaacagtttcgtcttg
aagaattttcctgcattgctgagcacaggggagttcttgaaactcccttttgagcgtctt
gccttcgtgctttccagtaatagccttaagcactgtactgaacttgagctctttaaggct
acctgtcgttggcttcgcctggaagagcctcggatggactttgctgcaaaattaatgaag
aacatacgatttccactgatgacaccacaggagctcattaattacgtgcaaacggtggat
ttcatgagaactgacaatacttgtgtgaatttgcttttggaagccagcaattaccaaatg
atgccatatatgcagccagttatgcagtcagacaggactgccattaggtctgacaccact
cacttggttacactaggaggagtgctgaggcagcagctggttgtcagtaaggaattgcgc
atgtatgatgaaaaggcccatgagtggaaatcgttagcccccatggatgccccaaggtac
cagcatggcatcgccgtcattggaaattttctctatgtggttggcggacagagtaattat
gatacaaaaggaaaaacggcagttgatacagtcttcagatttgatcctcgatacaataaa
tggatgcaagttgcatctttaaatgaaaagcgcaccttcttccacctaagtgccctcaaa
ggatatctgtatgcagttggtgggcgaaatgcagcaggtgaactgcccacagtagaatgt
tacaatccaagaacaaatgaatggacctatgttgccaaaatgagtgagccccactatggc
catgctggaactgtgtatggaggagtgatgtatatttcaggaggaattactcatgatact
ttccaaaaggagctcatgtgctttgaccctgatactgacaaatggatccagaaggcgcca
atgaccactgtcagaggtctgcattgcatgtgtacagtgggagaaaggctctatgtcatt
ggtggcaatcacttcagaggaacaagtgattatgatgatgtcctaagctgtgaatactat
tcacctatccttgaccagtggaccccaattgctgccatgttaagagggcagagtgatgtt
ggggtcgctgtcttcgaaaataaaatctatgtggttggggggtattcttggaataatcgt
tgtatggtagagatagtgcagaaatatgatccagataaagatgaatggcataaggttttt
gatctgccagaatcccttggtggcattcgtgcttgcacactcacagtttttccaccagaa
gaaaccacaccatcaccttctagagagtcccctctttctgcaccttaa

DBGET integrated database retrieval system