KEGG   Homo sapiens (human): 9033
Entry
9033              CDS       T01001                                 

Gene name
PKD2L1, PCL, PKD2L, PKDL, TRPP3
Definition
(RefSeq) polycystin 2 like 1, transient receptor potential cation channel
  KO
K04990  polycystin 2L1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    9033 (PKD2L1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    9033 (PKD2L1)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   9033 (PKD2L1)
SSDB
Motif
Pfam: PKD_channel Ion_trans Fer4_24 Baculo_PEP_C
Other DBs
NCBI-GeneID: 9033
NCBI-ProteinID: NP_057196
OMIM: 604532
HGNC: 9011
Ensembl: ENSG00000107593
Vega: OTTHUMG00000018910
Pharos: Q9P0L9(Tchem)
UniProt: Q9P0L9
Structure
PDB: 
3TE3 4GIF 6DU8

Position
10q24.31
AA seq 805 aa
MNAVGSPEGQELQKLGSGAWDNPAYSGPPSPHGTLRVCTISSTGPLQPQPKKPEDEPQET
AYRTQVSSCCLHICQGIRGLWGTTLTENTAENRELYIKTTLRELLVYIVFLVDICLLTYG
MTSSSAYYYTKVMSELFLHTPSDTGVSFQAISSMADFWDFAQGPLLDSLYWTKWYNNQSL
GHGSHSFIYYENMLLGVPRLRQLKVRNDSCVVHEDFREDILSCYDVYSPDKEEQLPFGPF
NGTAWTYHSQDELGGFSHWGRLTSYSGGGYYLDLPGSRQGSAEALRALQEGLWLDRGTRV
VFIDFSVYNANINLFCVLRLVVEFPATGGAIPSWQIRTVKLIRYVSNWDFFIVGCEVIFC
VFIFYYVVEEILELHIHRLRYLSSIWNILDLVVILLSIVAVGFHIFRTLEVNRLMGKLLQ
QPNTYADFEFLAFWQTQYNNMNAVNLFFAWIKIFKYISFNKTMTQLSSTLARCAKDILGF
AVMFFIVFFAYAQLGYLLFGTQVENFSTFIKCIFTQFRIILGDFDYNAIDNANRILGPAY
FVTYVFFVFFVLLNMFLAIINDTYSEVKEELAGQKDELQLSDLLKQGYNKTLLRLRLRKE
RVSDVQKVLQGGEQEIQFEDFTNTLRELGHAEHEITELTATFTKFDRDGNRILDEKEQEK
MRQDLEEERVALNTEIEKLGRSIVSSPQGKSGPEAARAGGWVSGEEFYMLTRRVLQLETV
LEGVVSQIDAVGSKLKMLERKGWLAPSPGVKEQAIWKHPQPAPAVTPDPWGVQGGQESEV
PYKREEEALEERRLSRGEIPTLQRS
NT seq 2418 nt   +upstreamnt  +downstreamnt
atgaatgctgtgggaagtcctgaggggcaggagctgcaaaagctggggagtggagcctgg
gacaaccccgcctacagtggtcccccttccccacacgggacgctgagagtctgcaccatc
tccagcacggggcctctccagccccaacccaagaagcctgaagatgaaccccaggagacg
gcatacaggacccaggtgtccagctgctgcctccatatctgtcaaggcatcagaggactt
tggggaacaaccctgactgagaacacagctgagaaccgggaactttatatcaagaccacc
ctgagggagctgttggtatatattgtgttcctggtggacatctgtctactgacctatgga
atgacaagctccagtgcttattactacaccaaagtgatgtctgagctcttcttacatact
ccatcagacactggagtctcctttcaggccatcagcagcatggcggacttctgggatttt
gcccagggcccactactggacagtttgtattggaccaaatggtacaacaaccagagcctg
ggccatggctcccactccttcatctactatgagaacatgctgctgggggttccgaggctg
cggcagctaaaggtccgcaatgactcctgtgtggtgcatgaagacttccgggaggacatt
ctgagctgctatgatgtctactctccagacaaagaagaacaactcccctttgggcccttc
aatggcacagcgtggacataccactcgcaggatgagttggggggcttctcccactggggc
aggctcacaagctacagcggaggtggctactacctggaccttccaggatcccgacagggt
agtgcagaggctctccgggcccttcaggaggggctgtggctggacaggggcactcgagtg
gtgttcatcgacttctcagtctacaatgccaatatcaatcttttctgtgtcctgaggctg
gtggtggagtttccagctacaggaggtgccatcccatcctggcaaatccgcacagtcaag
ctgatccgctatgtcagcaactgggacttctttatcgttggctgtgaggtcatcttctgc
gtcttcatcttctactatgtggtggaagagatcctggagctccacattcaccggcttcgc
tacctcagcagcatctggaacatactggacctggtggtcatcttgctctccattgtggct
gtgggcttccacatattccgaaccctcgaggtgaatcggctcatggggaagctcctgcag
cagccaaacacgtatgcagactttgagttcctcgccttctggcagacacagtacaacaac
atgaatgctgtcaacctcttcttcgcctggatcaagatattcaagtacatcagcttcaac
aaaaccatgacccagctctcctccacgctggcccgctgtgccaaggacatcctgggcttc
gccgtcatgttcttcattgttttcttcgcctatgcccaactcggctacctgcttttcggg
acccaagtggaaaactttagcactttcatcaagtgcattttcactcagttccggataatc
ctcggggactttgactacaatgctatcgacaatgccaaccgcatcctgggccctgcctac
tttgtcacctatgtcttcttcgtcttcttcgtgctcctgaacatgttcctggccatcatc
aatgacacatattcagaggtcaaggaggagctggctggacagaaggatgagctgcaactt
tctgacctcctgaaacagggctacaacaagaccctactaagactgcgtctgaggaaggag
agggtttcggatgtgcagaaggtcctgcagggtggggagcaggagatccagtttgaggat
ttcaccaacaccttaagggaactgggacacgcagagcatgaaatcactgagctcacggcc
accttcaccaagtttgacagagatgggaatcgtattctggatgagaaggaacaggaaaaa
atgcgacaggacctggaggaagagagggtggccctcaacactgagattgagaaactaggc
cgatctattgtgagcagcccacaaggcaaatcgggtccagaggctgccagagcaggaggc
tgggtttcaggagaagaattctacatgctcacaaggagagttctgcagctggagactgtc
ctggaaggagtagtgtcccagattgatgctgtaggctcaaagctgaaaatgctggagagg
aaggggtggctggctccctccccaggcgtgaaggaacaagctatttggaagcacccgcag
ccagccccagctgtgaccccagacccctggggagtccagggtgggcaggagagtgaggtt
ccctataaaagagaagaggaagccttagaggagaggagactctcccgtggtgagattcca
acgttgcagaggagttaa

DBGET integrated database retrieval system