KEGG   Homo sapiens (human): 9051
Entry
9051              CDS       T01001                                 

Symbol
PSTPIP1, CD2BP1, CD2BP1L, CD2BP1S, H-PIP, PAPAS, PSTPIP
Name
(RefSeq) proline-serine-threonine phosphatase interacting protein 1
  KO
K12804  proline-serine-threonine phosphatase interacting protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04621  NOD-like receptor signaling pathway
Disease
H00287  Pyogenic sterile arthritis, pyoderma gangrenosum, and acne syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    9051 (PSTPIP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9051 (PSTPIP1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Bin/Amphiphysin/Rvs (BAR) family proteins
   F-BAR proteins
    9051 (PSTPIP1)
SSDB
Motif
Pfam: SH3_1 SH3_9 FCH SH3_2 SH3_3 DUF3347 EzrA
Other DBs
NCBI-GeneID: 9051
NCBI-ProteinID: NP_003969
OMIM: 606347
HGNC: 9580
Ensembl: ENSG00000140368
Vega: OTTHUMG00000172594
Pharos: O43586(Tbio)
UniProt: O43586 A0A0S2Z5P3
Structure
PDB: 
2DIL

Position
15q24.3
AA seq 416 aa
MMPQLQFKDAFWCRDFTAHTGYEVLLQRLLDGRKMCKDMEELLRQRAQAEERYGKELVQI
ARKAGGQTEINSLRASFDSLKQQMENVGSSHIQLALTLREELRSLEEFRERQKEQRKKYE
AVMDRVQKSKLSLYKKAMESKKTYEQKCRDADDAEQAFERISANGHQKQVEKSQNKARQC
KDSATEAERVYRQSIAQLEKVRAEWEQEHRTTCEAFQLQEFDRLTILRNALWVHSNQLSM
QCVKDDELYEEVRLTLEGCSIDADIDSFIQAKSTGTEPPAPVPYQNYYDREVTPLTSSPG
IQPSCGMIKRFSGLLHGSPKTTSLAASAASTETLTPTPERNEGVYTAIAVQEIQGNPASP
AQEYRALYDYTAQNPDELDLSAGDILEVILEGEDGWWTVERNGQRGFVPGSYLEKL
NT seq 1251 nt   +upstreamnt  +downstreamnt
atgatgccccagctgcagttcaaagatgccttttggtgcagggacttcacagcccacacg
ggctacgaggtgctgctgcagcggcttctggatggcaggaagatgtgcaaagacatggag
gagctactgaggcagagggcccaggcggaggagcggtacgggaaggagctggtgcagatc
gcacggaaggcaggtggccagacggagatcaactccctgagggcctcctttgactccttg
aagcagcaaatggagaatgtgggcagctcacacatccagctggccctgaccctgcgtgag
gagctgcggagtctcgaggagtttcgtgagaggcagaaggagcagaggaagaagtatgag
gccgtcatggaccgggtccagaagagcaagctgtcgctctacaagaaggccatggagtcc
aagaagacatacgagcagaagtgccgggacgcggacgacgcggagcaggccttcgagcgc
attagcgccaacggccaccagaagcaggtggagaagagtcagaacaaagccaggcagtgc
aaggactcggccaccgaggcagagcgggtatacaggcagagcattgcgcagctggagaag
gtccgggctgagtgggagcaggagcaccggaccacctgtgaggcctttcagctgcaagag
tttgaccggctgaccattctccgcaacgccctgtgggtgcacagcaaccagctctccatg
cagtgtgtcaaggatgatgagctctacgaggaagtgcggctgacgctggaaggctgcagc
atagacgccgacatcgacagtttcatccaggccaagagcacgggcacagagccccccgct
ccggtgccctaccagaactattacgatcgggaggtcaccccgctgaccagcagccctggc
atacagccgtcctgcggcatgataaagaggttctctggactgctgcacggaagtcccaag
accacttcgttggcagcttctgctgcgtccacagagaccctgacccccacccccgagcgg
aatgagggtgtctacacagccatcgcagtgcaggagatacagggaaacccggcctcacca
gcccaggagtaccgggcgctctacgattatacagcgcagaacccagatgagctggacctg
tccgcgggagacatcctggaggtgatcctggaaggggaggatggctggtggactgtggag
aggaacgggcagcgtggcttcgtccctggttcctacctggagaagctttga

DBGET integrated database retrieval system