KEGG   Homo sapiens (human): 90874
Entry
90874             CDS       T01001                                 
Symbol
ZNF697
Name
(RefSeq) zinc finger protein 697
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 Zn-ribbon_8 zf-C2H2_jaz zf_UBZ zf-C2H2_6 DZR DUF2039 Yippee-Mis18 HVO_2753_ZBP zf-LYAR DUF2321 C1_4 DUF2256 Zn_ribbon_SprT
Other DBs
NCBI-GeneID: 90874
NCBI-ProteinID: NP_001073939
HGNC: 32034
Ensembl: ENSG00000143067
UniProt: Q5TEC3
Position
1:complement(119619377..119648266)
AA seq 545 aa
MKQEDNQGVCAHQDSEDKGMGSDFEDSEDREGDPEEREMGSNPHDTNKREGHPEPEMGSN
PQDSRHREAVPDICTEGQLSEEEGVSVRGEEDDQSGVADMAMFPGLSESDSISRSLREDD
DESAGENRLEEEEEQPAPPVLPWRRHLSLGSRHRGDKPAHRRFHRLHHPMAVDLGELDSL
VASIMDAPTICPDCGESFSPGAAFLQHQRIHRLAEAAAAASLEPFGLAGECDAMVGMMGV
GVAGGFGAGPPLARPPREKPFRCGECGKGFSRNTYLTNHLRLHTGERPNLCADCGKSFSW
RADLLKHRRLHTGEKPYPCPECGEAFSLSSHLLSHRRAHAAASGAGAAALRPFACGECGK
GFVRRSHLANHQRIHTGEKPHGCGECGKRFSWRSDLVKHQRVHTGEKPYMCSECGETFSV
SSHLFTHKRTHSGERPYVCRECGKGFGRNSHLVNHLRVHTGEKPFRCGQCEKRFSDFSTL
TQHQRTHTGEKPYTCIECGKSFIQSSHLIRHRRIHTGNKPHKCAGCGKGFRYKTHLAQHQ
KLHLC
NT seq 1638 nt   +upstreamnt  +downstreamnt
atgaaacaagaagataatcagggtgtctgtgcacaccaggactcagaagacaaagggatg
ggttctgattttgaggactctgaggacagggaaggggacccagaagaaagagaaatgggc
tctaatccacatgacacaaacaagagagaaggccatccggagccggagatgggctccaac
ccacaggactcaaggcacagggaagcagtgcccgacatctgcacagaggggcagctgagt
gaggaagaaggcgtttctgtccgtggggaagaggatgaccaatccggtgtagctgacatg
gcgatgttcccaggactgtctgagtctgacagcatatcccggagcctccgggaggacgac
gacgagagtgctggggagaaccggctggaggaggaagaggagcagccggcccctcccgta
cttccctggaggcgacatctctccctggggagtcggcaccgaggtgacaagcccgcccac
cgccgcttccaccggctccaccaccccatggccgtggacctcggggagctggatagcctg
gtggccagcatcatggacgcgcccaccatctgccccgactgcggggagagcttcagtcct
ggcgccgccttcctgcagcaccagcgcattcaccgcctggctgaggccgctgccgccgcc
agcctggagcccttcggcctggcgggcgagtgcgacgcgatggtgggcatgatgggggtg
ggtgtggcggggggcttcggggccgggcccccgctggcccggcccccgcgcgaaaagccc
ttccgctgcggggagtgcggcaagggcttcagccgcaacacctacctgaccaaccacctg
cgcctgcacacgggcgagcggcccaacctgtgcgccgactgcggcaagagcttcagctgg
cgcgccgacctgctcaagcaccggcgcctgcacacgggcgagaagccctacccgtgcccc
gagtgcggcgaggccttcagcctcagctcgcatctgttgagccaccggcgcgcgcacgcg
gcggccagcggcgcgggggcggcggcgctgcggcccttcgcctgcggggagtgcggcaag
ggcttcgtgcgccgttcgcacctggccaaccaccagcgcatccacacgggcgagaagccg
cacggctgtggcgagtgcggcaagcgcttcagctggcgctcggacttggtgaagcaccag
cgcgtgcacacgggcgagaagccctacatgtgctccgagtgcggcgagaccttcagcgtc
agctcgcacctcttcacgcacaagcgcacgcactcgggtgagcggccctacgtgtgccgc
gagtgcgggaagggcttcgggcgtaactcgcacctggtgaaccacctgcgcgtgcacacc
ggcgagaagcccttccgctgtggccagtgcgagaagcgcttcagcgacttctccacgctc
acgcagcaccagcgcacgcacacgggcgagaagccctacacgtgcatcgagtgcggcaag
agctttatccagagctcccacctgatccgccaccgccgcatccacacgggcaacaagccg
cacaagtgtgcgggctgcggcaaaggcttccgctataaaacgcacctcgcgcagcaccag
aagctgcacctgtgttag

DBGET integrated database retrieval system