KEGG   Homo sapiens (human): 90993Help
Entry
90993             CDS       T01001                                 

Gene name
CREB3L1, OASIS, OI16
Definition
(RefSeq) cAMP responsive element binding protein 3 like 1
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04211  Longevity regulating pathway
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04668  TNF signaling pathway
hsa04714  Thermogenesis
hsa04725  Cholinergic synapse
hsa04728  Dopaminergic synapse
hsa04911  Insulin secretion
hsa04915  Estrogen signaling pathway
hsa04916  Melanogenesis
hsa04918  Thyroid hormone synthesis
hsa04922  Glucagon signaling pathway
hsa04925  Aldosterone synthesis and secretion
hsa04926  Relaxin signaling pathway
hsa04927  Cortisol synthesis and secretion
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04931  Insulin resistance
hsa04934  Cushing syndrome
hsa04962  Vasopressin-regulated water reabsorption
hsa05016  Huntington disease
hsa05030  Cocaine addiction
hsa05031  Amphetamine addiction
hsa05034  Alcoholism
hsa05161  Hepatitis B
hsa05163  Human cytomegalovirus infection
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05203  Viral carcinogenesis
hsa05215  Prostate cancer
Network
N00297  ACTH-cortisol signaling pathway
N00298  CYP11B1-CYP11B2 fusion to ACTH-cortisol signaling pathway
N00301  Angiotensin-aldosterone signaling pathway
N00302  Mutation-activated CACNA1D/H to angiotensin-aldosterone signaling pathway
N00303  Mutation-activated KCNJ5 to angiotensin-aldosterone signaling pathway
N00304  Mutation-inactivated ATP1A1 to angiotensin-aldosterone signaling pathway
N00305  Mutation-inactivated ATP2B3 to angiotensin-aldosterone signaling pathway
N00320  Mutation-activated PRKACA to ACTH-cortisol signaling pathway
N00321  Mutation-activated GNAS to ACTH-cortisol signaling pathway
N00322  Mutation-inactivated PRKAR1A to ACTH-cortisol signaling pathway
N00323  Mutation-inactivated PDE11A/PDE8B to ACTH-cortisol signaling pathway
N00324  CRHR-PKA-ACTH signaling pathway
N00325  Mutation-inactivated RASD1 to CRHR-PKA-ACTH signaling pathway
N00326  Mutation-activated GNAS to CRHR-PKA-ACTH signaling pathway
N00327  Mutation-inactivated PRKAR1A to CRHR-PKA-ACTH signaling pathway
N00409  HCMV UL33 to GNB/G-Rho signaling pathway
N00410  DRD1-GNAS-AC-PKA signaling pathway
N00411  HCMV UL33 to GNAS-AC-PKA signaling pathway
N00412  HCMV UL33 to GNAI-AC-PKA signaling pathway
N00444  TNF-p38 signaling pathway
N00510  HTLV-1 Tax to CREB-mediated transcription
 » show all
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    90993 (CREB3L1)
   04024 cAMP signaling pathway
    90993 (CREB3L1)
   04022 cGMP-PKG signaling pathway
    90993 (CREB3L1)
   04151 PI3K-Akt signaling pathway
    90993 (CREB3L1)
   04152 AMPK signaling pathway
    90993 (CREB3L1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    90993 (CREB3L1)
   04922 Glucagon signaling pathway
    90993 (CREB3L1)
   04915 Estrogen signaling pathway
    90993 (CREB3L1)
   04926 Relaxin signaling pathway
    90993 (CREB3L1)
   04918 Thyroid hormone synthesis
    90993 (CREB3L1)
   04928 Parathyroid hormone synthesis, secretion and action
    90993 (CREB3L1)
   04916 Melanogenesis
    90993 (CREB3L1)
   04925 Aldosterone synthesis and secretion
    90993 (CREB3L1)
   04927 Cortisol synthesis and secretion
    90993 (CREB3L1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    90993 (CREB3L1)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    90993 (CREB3L1)
  09156 Nervous system
   04725 Cholinergic synapse
    90993 (CREB3L1)
   04728 Dopaminergic synapse
    90993 (CREB3L1)
  09149 Aging
   04211 Longevity regulating pathway
    90993 (CREB3L1)
  09159 Environmental adaptation
   04714 Thermogenesis
    90993 (CREB3L1)
 09160 Human Diseases
  09161 Cancers: Overview
   05203 Viral carcinogenesis
    90993 (CREB3L1)
  09162 Cancers: Specific types
   05215 Prostate cancer
    90993 (CREB3L1)
  09164 Neurodegenerative diseases
   05016 Huntington disease
    90993 (CREB3L1)
  09165 Substance dependence
   05030 Cocaine addiction
    90993 (CREB3L1)
   05031 Amphetamine addiction
    90993 (CREB3L1)
   05034 Alcoholism
    90993 (CREB3L1)
  09167 Endocrine and metabolic diseases
   04931 Insulin resistance
    90993 (CREB3L1)
   04934 Cushing syndrome
    90993 (CREB3L1)
  09172 Infectious diseases: Viral
   05166 Human T-cell leukemia virus 1 infection
    90993 (CREB3L1)
   05161 Hepatitis B
    90993 (CREB3L1)
   05163 Human cytomegalovirus infection
    90993 (CREB3L1)
   05165 Human papillomavirus infection
    90993 (CREB3L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    90993 (CREB3L1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   CREB
    90993 (CREB3L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf LMBR1 ELP6 HAUS-augmin3 JMY APG6_N TPR_MLP1_2 Jnk-SapK_ap_N DUF3552 DUF4404 ADIP
Motif
Other DBs
NCBI-GeneID: 90993
NCBI-ProteinID: NP_443086
OMIM: 616215
HGNC: 18856
Ensembl: ENSG00000157613
Vega: OTTHUMG00000166423
Pharos: Q96BA8(Tbio)
UniProt: Q96BA8 B2RA75
Position
11p11.2
AA seq 519 aa AA seqDB search
MDAVLEPFPADRLFPGSSFLDLGDLNESDFLNNAHFPEHLDHFTENMEDFSNDLFSSFFD
DPVLDEKSPLLDMELDSPTPGIQAEHSYSLSGDSAPQSPLVPIKMEDTTQDAEHGAWALG
HKLCSIMVKQEQSPELPVDPLAAPSAMAAAAAMATTPLLGLSPLSRLPIPHQAPGEMTQL
PVIKAEPLEVNQFLKVTPEDLVQMPPTPPSSHGSDSDGSQSPRSLPPSSPVRPMARSSTA
ISTSPLLTAPHKLQGTSGPLLLTEEEKRTLIAEGYPIPTKLPLTKAEEKALKRVRRKIKN
KISAQESRRKKKEYVECLEKKVETFTSENNELWKKVETLENANRTLLQQLQKLQTLVTNK
ISRPYKMAATQTGTCLMVAALCFVLVLGSLVPCLPEFSSGSQTVKEDPLAADGVYTASQM
PSRSLLFYDDGAGLWEDGRSTLLPMEPPDGWEINPGGPAEQRPRDHLQHDHLDSTHETTK
YLSEAWPKDGGNGTSPDFSHSKEWFHDRDLGPNTTIKLS
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atggacgccgtcttggaacccttcccggccgacaggctgttccccggatccagcttcctg
gacttgggggatctgaacgagtcggacttcctcaacaatgcgcactttcctgagcacctg
gaccactttacggagaacatggaggacttctccaatgacctgttcagcagcttctttgat
gaccctgtgctggatgagaagagccctctattggacatggaactggactcccctacgcca
ggcatccaggcggagcacagctactccctgagcggcgactcagcgccccagagccccctt
gtgcccatcaagatggaggacaccacccaagatgcagagcatggagcatgggcgctggga
cacaaactgtgctccatcatggtgaagcaggagcagagcccggagctgcccgtggaccct
ctggctgccccctcggccatggctgccgcggccgccatggccaccaccccgctgctgggc
ctcagccccttgtccaggctgcccatcccccaccaggccccgggagagatgactcagctg
ccagtgatcaaagcagagcctctggaggtgaaccagttcctcaaagtgacaccggaggac
ctggtgcagatgcctccgacgccccccagcagccatggcagtgacagcgacggctcccag
agtccccgctctctgcccccctccagccctgtcaggcccatggcgcgctcctccacggcc
atctccacctccccactcctcactgcccctcacaaattacaggggacatcagggccactg
ctcctgacagaggaggagaagcggaccctgattgctgagggctaccccatccccacaaaa
ctccccctcaccaaagccgaggagaaggccttgaagagagtccggaggaaaatcaagaac
aagatctcagcccaggagagccgtcgtaagaagaaggagtatgtggagtgtctagaaaag
aaggtggagacatttacatctgagaacaatgaactgtggaagaaggtggagaccctggag
aatgccaacaggaccctgctccagcagctgcagaaactccagactctggtcaccaacaag
atctccagaccttacaagatggccgccacccagactgggacctgcctcatggtggcagcc
ttgtgctttgttctggtgctgggctccctcgtgccctgccttcccgagttctcctccggc
tcccagactgtgaaggaagaccccctggccgcagacggcgtctacacggccagccagatg
ccctcccgaagcctcctattctacgatgacggggcaggcttatgggaagatggccgcagc
accctgctgcccatggagcccccagatggctgggaaatcaaccccggggggccggcagag
cagcggccccgggaccacctgcagcatgatcacctggacagcacccacgagaccaccaag
tacctgagtgaggcctggcctaaagacggtggaaacggcaccagccccgacttctcccac
tccaaggagtggttccacgacagggatctgggccccaacaccaccatcaaactctcctag

DBGET integrated database retrieval system