KEGG   Homo sapiens (human): 9227Help
Entry
9227              CDS       T01001                                 

Gene name
LRAT, LCA14
Definition
(RefSeq) lecithin retinol acyltransferase
  KO
K00678  phosphatidylcholine-retinol O-acyltransferase [EC:2.3.1.135]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00830  Retinol metabolism
hsa04977  Vitamin digestion and absorption
Disease
H00527  Retinitis pigmentosa
H00837  Leber congenital amaurosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    9227 (LRAT)
 09150 Organismal Systems
  09154 Digestive system
   04977 Vitamin digestion and absorption
    9227 (LRAT)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.135  phosphatidylcholine---retinol O-acyltransferase
     9227 (LRAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRAT NLPC_P60
Motif
Other DBs
NCBI-GeneID: 9227
NCBI-ProteinID: NP_001288574
OMIM: 604863
HGNC: 6685
Ensembl: ENSG00000121207
Vega: OTTHUMG00000161418
Pharos: O95237(Tbio)
UniProt: O95237
Position
4q32.1
AA seq 230 aa AA seqDB search
MKNPMLEVVSLLLEKLLLISNFTLFSSGAAGEDKGRNSFYETSSFHRGDVLEVPRTHLTH
YGIYLGDNRVAHMMPDILLALTDDMGRTQKVVSNKRLILGVIVKVASIRVDTVEDFAYGA
NILVNHLDESLQKKALLNEEVARRAEKLLGFTPYSLLWNNCEHFVTYCRYGTPISPQSDK
FCETVKIIIRDQRSVLASAVLGLASIVCTGLVSYTTLPAIFIPFFLWMAG
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaccccatgctggaggtggtgtctttactactggagaagctgctcctcatctcc
aacttcacgctctttagttcgggcgccgcgggcgaagacaaagggaggaacagtttttat
gaaaccagctctttccaccgaggcgacgtgctggaggtgccccggacccacctgacccac
tatggcatctacctaggagacaaccgtgttgcccacatgatgcccgacatcctgttggcc
ctgacagacgacatggggcgcacgcagaaggtggtctccaacaagcgtctcatcctgggc
gttattgtcaaagtggccagcatccgcgtggacacagtggaggacttcgcctacggagct
aacatcctggtcaatcacctggacgagtccctccagaaaaaggcactgctcaacgaggag
gtggcgcggagggctgaaaagctgctgggctttaccccctacagcctgctgtggaacaac
tgcgagcacttcgtgacctactgcagatatggcaccccgatcagtccccagtccgacaag
ttttgtgagactgtgaagataattattcgtgatcagagaagtgttcttgcttcagcagtc
ttgggattggcgtctatagtctgtacgggcttggtatcatacactacccttcctgcaatt
tttattccattcttcctatggatggctggctaa

DBGET integrated database retrieval system