KEGG   Homo sapiens (human): 92822
Entry
92822             CDS       T01001                                 
Symbol
ZNF276, CENP-Z, CENPZ, ZADT, ZFP276, ZNF477
Name
(RefSeq) zinc finger protein 276
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-H2C2_2 zf-AD zf-C2H2_aberr CpXC RBR zf-C2H2_6 DUF6301 Zn-ribbon_8 zf_UBZ DUF2197
Other DBs
NCBI-GeneID: 92822
NCBI-ProteinID: NP_001106997
OMIM: 608460
HGNC: 23330
Ensembl: ENSG00000158805
UniProt: Q8N554 I6L9I3
Position
16:89720368..89740925
AA seq 614 aa
MKRDRLGRFLSPGSSRQCGASDGGGGVSRTRGRPSLSGGPRVDGATARRAWGPVGSCGDA
GEDGADEAGAGRALAMGHCRLCHGKFSSRSLRSISERAPGASMERPSAEERVLVRDFQRL
LGVAVRQDPTLSPFVCKSCHAQFYQCHSLLKSFLQRVNASPAGRRKPCAKVGAQPPTGAE
EGACLVDLITSSPQCLHGLVGWVHGHAASCGALPHLQRTLSSEYCGVIQVVWGCDQGHDY
TMDTSSSCKAFLLDSALAVKWPWDKETAPRLPQHRGWNPGDAPQTSQGRGTGTPVGAETK
TLPSTDVAQPPSDSDAVGPRSGFPPQPSLPLCRAPGQLGEKQLPSSTSDDRVKDEFSDLS
EGDVLSEDENDKKQNAQSSDESFEPYPERKVSGKKSESKEAKKSEEPRIRKKPGPKPGWK
KKLRCEREELPTIYKCPYQGCTAVYRGADGMKKHIKEHHEEVRERPCPHPGCNKVFMIDR
YLQRHVKLIHTEVRNYICDECGQTFKQRKHLLVHQMRHSGAKPLQCEVCGFQCRQRASLK
YHMTKHKAETELDFACDQCGRRFEKAHNLNVHMSMVHPLTQTQDKALPLEAEPPPGPPSP
SVTTEGQAVKPEPT
NT seq 1845 nt   +upstreamnt  +downstreamnt
atgaagcgggaccggctgggccgcttcctgtctcctgggtcgtcccgacagtgcggggcc
tcggacggcggcggcggcgtcagccggactcggggccgcccttcccttagcggtgggccg
agggtggacggggcgacggcgcggcgcgcctggggcccggtggggtcctgcggggacgcg
ggcgaggacggcgcggacgaggcaggagcaggccgggctctcgccatgggtcactgtcgc
ctctgccacgggaagttttcctcgagaagcctgcgcagcatctccgagagggcgcctgga
gcgagcatggagaggccatccgcagaggagcgcgtgctcgtacgggacttccagcgcctg
cttggtgtggctgtccgccaggaccccaccttgtctccgtttgtctgcaagagctgccac
gcccagttctaccagtgccacagccttctcaagtccttcctgcagagggtcaacgcctcc
ccggctggtcgccggaagccttgtgcaaaggtcggtgcccagcccccaacaggggcagag
gagggagcgtgtctggtggatctgatcacatccagcccccagtgcctgcacggcttggtg
gggtgggtgcatggacatgcggccagctgcggggccctgccccaccttcagaggacactg
tcctccgagtactgcggcgtcatccaggtcgtgtggggctgcgaccagggccacgactac
accatggataccagctccagctgcaaggccttcttgctggacagtgcgctggcagtcaag
tggccatgggacaaagagacggcgccacggctgccccagcaccgagggtggaaccctggg
gatgcccctcagacctcccagggtagagggacagggaccccagttggggctgagaccaag
accctgcccagcacggatgtggcccagcctccttcggacagcgacgcggtggggcccagg
tcgggcttcccacctcagccaagcctgcccctttgcagggccccagggcagttgggtgag
aagcagcttccatcttcaacctcggatgatcgggtaaaagacgagttcagtgacctttct
gagggagacgtcttgagtgaagatgaaaatgacaagaagcaaaatgcccagtcttcggac
gagtcctttgagccttacccagaaaggaaagtctctggtaagaagagtgaaagcaaagaa
gccaagaagtctgaagaaccaagaattcggaagaagccgggacccaagcccggatggaag
aagaagcttcgttgtgagagggaggagcttcccaccatctacaagtgtccttaccagggc
tgcacggccgtgtaccgaggcgctgacggcatgaagaagcacatcaaggagcaccacgag
gaggtccgggagcggccctgcccccaccctggctgcaacaaggttttcatgatcgaccgc
tacctgcagcgccacgtgaagctcatccacacagaggtgcggaactatatctgtgacgaa
tgtggacaaaccttcaagcagcggaagcaccttctcgtccaccaaatgcgacattcggga
gccaagcctttgcagtgtgaggtctgtgggttccagtgcaggcagcgggcatccctcaag
taccacatgaccaaacacaaggctgagactgagctggactttgcctgtgaccagtgtggc
cggcggtttgagaaggcccacaacctcaatgtacacatgtccatggtgcacccgctgaca
cagacccaggacaaggccctgcccctggaggcggaaccaccacctgggccaccgagcccc
tctgtgaccacagagggccaggcggtgaagcccgaacccacctga

DBGET integrated database retrieval system