KEGG   Homo sapiens (human): 9568Help
Entry
9568              CDS       T01001                                 

Gene name
GABBR2, EIEE59, GABABR2, GPR51, GPRC3B, HG20, HRIHFB2099, NDPLHS
Definition
(RefSeq) gamma-aminobutyric acid type B receptor subunit 2
  KO
K04615  gamma-aminobutyric acid type B receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04727  GABAergic synapse
hsa04742  Taste transduction
hsa04915  Estrogen signaling pathway
hsa05032  Morphine addiction
Drug target
Aminobutyric acid: D00058
Arbaclofen (DG01354): D08861 D09791
Baclofen: D00241
Progabide: D05621
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    9568 (GABBR2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    9568 (GABBR2)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    9568 (GABBR2)
  09156 Nervous system
   04727 GABAergic synapse
    9568 (GABBR2)
  09157 Sensory system
   04742 Taste transduction
    9568 (GABBR2)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    9568 (GABBR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    9568 (GABBR2)
G protein-coupled receptors [BR:hsa04030]
 Metabotropic glutamate receptor family
  GABA
   9568 (GABBR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_3 ANF_receptor GBR2_CC Peripla_BP_6 Cation_ATPase_C UPF0242 GAPT HOOK
Motif
Other DBs
NCBI-GeneID: 9568
NCBI-ProteinID: NP_005449
OMIM: 607340
HGNC: 4507
Ensembl: ENSG00000136928
Vega: OTTHUMG00000020345
Pharos: O75899(Tclin)
UniProt: O75899 H9NIL8
Structure
PDB: 

Position
9q22.33
AA seq 941 aa AA seqDB search
MASPRSSGQPGPPPPPPPPPARLLLLLLLPLLLPLAPGAWGWARGAPRPPPSSPPLSIMG
LMPLTKEVAKGSIGRGVLPAVELAIEQIRNESLLRPYFLDLRLYDTECDNAKGLKAFYDA
IKYGPNHLMVFGGVCPSVTSIIAESLQGWNLVQLSFAATTPVLADKKKYPYFFRTVPSDN
AVNPAILKLLKHYQWKRVGTLTQDVQRFSEVRNDLTGVLYGEDIEISDTESFSNDPCTSV
KKLKGNDVRIILGQFDQNMAAKVFCCAYEENMYGSKYQWIIPGWYEPSWWEQVHTEANSS
RCLRKNLLAAMEGYIGVDFEPLSSKQIKTISGKTPQQYEREYNNKRSGVGPSKFHGYAYD
GIWVIAKTLQRAMETLHASSRHQRIQDFNYTDHTLGRIILNAMNETNFFGVTGQVVFRNG
ERMGTIKFTQFQDSREVKVGEYNAVADTLEIINDTIRFQGSEPPKDKTIILEQLRKISLP
LYSILSALTILGMIMASAFLFFNIKNRNQKLIKMSSPYMNNLIILGGMLSYASIFLFGLD
GSFVSEKTFETLCTVRTWILTVGYTTAFGAMFAKTWRVHAIFKNVKMKKKIIKDQKLLVI
VGGMLLIDLCILICWQAVDPLRRTVEKYSMEPDPAGRDISIRPLLEHCENTHMTIWLGIV
YAYKGLLMLFGCFLAWETRNVSIPALNDSKYIGMSVYNVGIMCIIGAAVSFLTRDQPNVQ
FCIVALVIIFCSTITLCLVFVPKLITLRTNPDAATQNRRFQFTQNQKKEDSKTSTSVTSV
NQASTSRLEGLQSENHRLRMKITELDKDLEEVTMQLQDTPEKTTYIKQNHYQELNDILNL
GNFTESTDGGKAILKNHLDQNPQLQWNTTEPSRTCKDPIEDINSPEHIQRRLSLQLPILH
HAYLPSIGGVDASCVSPCVSPTASPRHRHVPPSFRVMVSGL
NT seq 2826 nt NT seq  +upstreamnt  +downstreamnt
atggcttccccgcggagctccgggcagcccgggccgccgccgccgccgccaccgccgccc
gcgcgcctgctactgctactgctgctgccgctgctgctgcctctggcgcccggggcctgg
ggctgggcgcggggcgccccccggccgccgcccagcagcccgccgctctccatcatgggc
ctcatgccgctcaccaaggaggtggccaagggcagcatcgggcgcggtgtgctccccgcc
gtggaactggccatcgagcagatccgcaacgagtcactcctgcgcccctacttcctcgac
ctgcggctctatgacacggagtgcgacaacgcaaaagggttgaaagccttctacgatgca
ataaaatacgggcctaaccacttgatggtgtttggaggcgtctgtccatccgtcacatcc
atcattgcagagtccctccaaggctggaatctggtgcagctttcttttgctgcaaccacg
cctgttctagccgataagaaaaaatacccttatttctttcggaccgtcccatcagacaat
gcggtgaatccagccattctgaagttgctcaagcactaccagtggaagcgcgtgggcacg
ctgacgcaagacgttcagaggttctctgaggtgcggaatgacctgactggagttctgtat
ggcgaggacattgagatttcagacaccgagagcttctccaacgatccctgtaccagtgtc
aaaaagctgaaggggaatgatgtgcggatcatccttggccagtttgaccagaatatggca
gcaaaagtgttctgttgtgcatacgaggagaacatgtatggtagtaaatatcagtggatc
attccgggctggtacgagccttcttggtgggagcaggtgcacacggaagccaactcatcc
cgctgcctccggaagaatctgcttgctgccatggagggctacattggcgtggatttcgag
cccctgagctccaagcagatcaagaccatctcaggaaagactccacagcagtatgagaga
gagtacaacaacaagcggtcaggcgtggggcccagcaagttccacgggtacgcctacgat
ggcatctgggtcatcgccaagacactgcagagggccatggagacactgcatgccagcagc
cggcaccagcggatccaggacttcaactacacggaccacacgctgggcaggatcatcctc
aatgccatgaacgagaccaacttcttcggggtcacgggtcaagttgtattccggaatggg
gagagaatggggaccattaaatttactcaatttcaagacagcagggaggtgaaggtggga
gagtacaacgctgtggccgacacactggagatcatcaatgacaccatcaggttccaagga
tccgaaccaccaaaagacaagaccatcatcctggagcagctgcggaagatctccctacct
ctctacagcatcctctctgccctcaccatcctcgggatgatcatggccagtgcttttctc
ttcttcaacatcaagaaccggaatcagaagctcataaagatgtcgagtccatacatgaac
aaccttatcatccttggagggatgctctcctatgcttccatatttctctttggccttgat
ggatcctttgtctctgaaaagacctttgaaacactttgcaccgtcaggacctggattctc
accgtgggctacacgaccgcttttggggccatgtttgcaaagacctggagagtccacgcc
atcttcaaaaatgtgaaaatgaagaagaagatcatcaaggaccagaaactgcttgtgatc
gtggggggcatgctgctgatcgacctgtgtatcctgatctgctggcaggctgtggacccc
ctgcgaaggacagtggagaagtacagcatggagccggacccagcaggacgggatatctcc
atccgccctctcctggagcactgtgagaacacccatatgaccatctggcttggcatcgtc
tatgcctacaagggacttctcatgttgttcggttgtttcttagcttgggagacccgcaac
gtcagcatccccgcactcaacgacagcaagtacatcgggatgagtgtctacaacgtgggg
atcatgtgcatcatcggggccgctgtctccttcctgacccgggaccagcccaatgtgcag
ttctgcatcgtggctctggtcatcatcttctgcagcaccatcaccctctgcctggtattc
gtgccgaagctcatcaccctgagaacaaacccagatgcagcaacgcagaacaggcgattc
cagttcactcagaatcagaagaaagaagattctaaaacgtccacctcggtcaccagtgtg
aaccaagccagcacatcccgcctggagggcctacagtcagaaaaccatcgcctgcgaatg
aagatcacagagctggataaagacttggaagaggtcaccatgcagctgcaggacacacca
gaaaagaccacctacattaaacagaaccactaccaagagctcaatgacatcctcaacctg
ggaaacttcactgagagcacagatggaggaaaggccattttaaaaaatcacctcgatcaa
aatccccagctacagtggaacacaacagagccctctcgaacatgcaaagatcctatagaa
gatataaactctccagaacacatccagcgtcggctgtccctccagctccccatcctccac
cacgcctacctcccatccatcggaggcgtggacgccagctgtgtcagcccctgcgtcagc
cccaccgccagcccccgccacagacatgtgccaccctccttccgagtcatggtctcgggc
ctgtaa

DBGET integrated database retrieval system